SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000023299 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000023299
Domain Number 1 Region: 41-243
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.61e-16
Family WD40-repeat 0.022
Further Details:      
 
Domain Number 2 Region: 768-836
Classification Level Classification E-value
Superfamily RING/U-box 0.00003
Family RING finger domain, C3HC4 0.03
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000023299
Domain Number - Region: 491-650
Classification Level Classification E-value
Superfamily ARM repeat 0.00529
Family Clathrin heavy chain proximal leg segment 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000023299   Gene: ENSCJAG00000012686   Transcript: ENSCJAT00000024651
Sequence length 851
Comment pep:novel chromosome:C_jacchus3.2.1:8:6495297:6667826:-1 gene:ENSCJAG00000012686 transcript:ENSCJAT00000024651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AITGVIDIVEGSNSGSPEEESEEEPKLKYERLSNGVTEILQKDAASCMTVHDKFLALGTH
YGKVCLLDVQGNITQKFDVSPVKINQISLDESGEHMGVCSEDGKVQVFGLYSGEEFHETF
DCPIKIIAVHPHFVRSSCKQFVTGGTKLLLFERSWMNRWKSAVLHEGEGNIRSVKWRGHL
IAWANNMGVKIFDIISKQRITNVPRDDISLRPDMYPCSLCWKDNVTLIIGWGTSVKICSV
KERHASEMRDLPSRYVEIVSQFETEFYISGLAPLCDQLVVLSYVKEISEKTGREYCARPR
LDIIQPLSETCEEISSDALTVRGFQENECRDYHLEYSEGESLFYIVSPRDVVVAKERDQD
DHIDWLLEKKKYEEALMAAEISQKNIKRHKILDIGLAYINHLVERGDYDIAARKCQKILG
KNAALWEYEVYKFKEIGQLKAISPYLPRGDPVLKPLIYEMILHEFLESDYEGFATLIREW
PGDLYNNSVIVQAVRDHLKKDTQNKTLLKTLAELYTYDKNYGNALEIYLTLRHKDVFQLI
HKHNLFSSIKDKIVLLMDFDSEKAVDMLLDNEDKISIKKVVEELEDRPELQHVYLHKLFK
RDHHKGQRYHEKQISLYAEYDRPNLLPFLRDSTHCPLEKALEICQQRNFVEETVYLLSRM
GNSRSALKMIMEELHDVDKAIEFAKEQDDGELWEDLILYSIDKPPFITGLLNNIGTHVDP
ILLIHRIKEGMEIPNLRDSLVKILQDYNLQILLREGCKKILVADSLSLLKKMHRTQMKGV
LVDEENICESCLSPILPSDAAKPFSVVVFHCRHMFHKECLPMPSMNSAAQFCNICTAKNR
GPGSAILEMKT
Download sequence
Identical sequences F7IKK8
ENSCJAP00000023266 ENSCJAP00000023299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]