SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000023759 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000023759
Domain Number 1 Region: 5-80
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-19
Family PDZ domain 0.00072
Further Details:      
 
Domain Number 2 Region: 281-310
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000252
Family LIM domain 0.0027
Further Details:      
 
Domain Number 3 Region: 249-280
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000233
Family LIM domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000023759   Gene: ENSCJAG00000012942   Transcript: ENSCJAT00000025134
Sequence length 331
Comment pep:known chromosome:C_jacchus3.2.1:2:73198624:73216394:-1 gene:ENSCJAG00000012942 transcript:ENSCJAT00000025134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHSVTLRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIEAINGESTELM
THLEAQNRIKCCHDHLTLSVSMVPEGRSWPSAPDDSKAQAHRIHIDPEAQDGSPTTSRRP
SGTGTGPEDGRPSLGSPYGQPPRFPVPHNGSSEATLPAQMSTLHVSPPPSADPARGLPRS
RDCRVDLGSEVYRMLREPAEPVAAEPKQSGSFRYLQGMLEAGESGERPGPGGPRNLKPTA
GKLSAPLSGLQGLPECTRCGHGIVGTIVKARDKLYHPECFMCSDCGLNLKQRGYFFLDER
LYCESHAKARVKPPEGYDVVAVYPNAKVELV
Download sequence
Identical sequences F7FMJ5
ENSCJAP00000023759 ENSCJAP00000023746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]