SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000023963 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000023963
Domain Number 1 Region: 165-236
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000144
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000023963
Domain Number - Region: 4-45
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000149
Family FHA domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000023963   Gene: ENSCJAG00000013030   Transcript: ENSCJAT00000025348
Sequence length 533
Comment pep:novel chromosome:C_jacchus3.2.1:9:123910453:123926772:-1 gene:ENSCJAG00000013030 transcript:ENSCJAT00000025348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCDLSFPSNKLVSGDHCKIVVDEKSGQVTLEDTSVSSSSLRSLTLCIRSALCAMAKSLFL
YILTRKWKPWDRRLGRGGLRGGCSGRRNTCDQVTTKPTLFTICLQNSFATLVPQQTVVAT
QMEPMRKKMKGAGDLDLNLEVLVAQPCRNTQTVHDDVRAAAGKPDKMEETLTCIICQDLL
HDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERICKNHILNNLVEAYLIQHPDKSR
SEEDVQSMDARNKITQDMLQPKVRRSFSDEDGSSEDLLELSDVDSESSDISQPYVVCRQC
PEYRRQAAQPPHCPAPEGEPGAPQALGDTPSTSASLMTAVQDYVCPLQGSHALCTCCFQP
MPDRRAEREQDPSVAPQQCAVCLQPFCHLYWGCTRTGCFGCLAPFCELNLGDKCLDGVLN
NNSYESDILKNYLATRGLTWKNMLTESLVALQRGVFLLSDYRVTGNTVLCYCCGLRSFRE
LTYQYRQNIPASELPVAVTSRPDCYWGRNCRTQVKAHHAMKFNHICEQTRFKN
Download sequence
Identical sequences F7EU17
ENSCJAP00000023963 ENSCJAP00000023973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]