SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024045 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000024045
Domain Number 1 Region: 354-477
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.99e-35
Family DEP domain 0.000022
Further Details:      
 
Domain Number 2 Region: 177-286
Classification Level Classification E-value
Superfamily PDZ domain-like 4.26e-23
Family PDZ domain 0.0000331
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000024045
Domain Number - Region: 2-28
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000548
Family DIX domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024045   Gene: ENSCJAG00000013060   Transcript: ENSCJAT00000025435
Sequence length 664
Comment pep:known chromosome:C_jacchus3.2.1:15:5761210:5771972:1 gene:ENSCJAG00000013060 transcript:ENSCJAT00000025435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELPPPMERTGGIGDS
RPPSFHPHAGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHAARLNGTAKGERRREPGG
YDSSPTLMSSELETTSFCDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERX
SSFSSITDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGR
IEPGDMLLQVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEP
IRPIDPAAWVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDM
AAIVKAMASPESGFEVRERMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLL
KAGFIRHTVNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPW
PMAFPYQYPPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPK
AGDSKSGGSGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLASSLRSHHTHPS
YGPPGVPPLYGPPMLMMPPPPTAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPSEFF
VDVM
Download sequence
Identical sequences F7GTM6
ENSCJAP00000024045 ENSCJAP00000024045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]