SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024627 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000024627
Domain Number 1 Region: 947-1220
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 3.14e-57
Family Patatin 0.058
Further Details:      
 
Domain Number 2 Region: 164-302
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.71e-22
Family cAMP-binding domain 0.021
Further Details:      
 
Domain Number 3 Region: 609-724
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.28e-22
Family cAMP-binding domain 0.0074
Further Details:      
 
Domain Number 4 Region: 495-614
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-18
Family cAMP-binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024627   Gene: ENSCJAG00000013340   Transcript: ENSCJAT00000026046
Sequence length 1342
Comment pep:known chromosome:C_jacchus3.2.1:1:181584746:181660098:-1 gene:ENSCJAG00000013340 transcript:ENSCJAT00000026046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEKDVSPEAGFCLGTTLHSWGLQFTEEGSPSTMLAGIAVGALLALALGGVVILFMFRR
LSRFRQAQPTPQYRFRKRDKVMFYGRKIMRKVTTLPNTLVENTALPRQRARRRTKVLSLA
KRILRFKKEYPALQPKEPPPSLLEADLTEFDVKNSHLPSEVLYMLKNVRVLGHFEKPLFL
ELCKHIVFVQLQEGEHIFQPGEPDPSICVVQDGRLEVCIQDADGPEVVVKEVLAGDSVHS
LLSILDIITGHTAPYKTVSARAAIPSTILRLPAAAFQGVFEKYPETLVRVVQIIMVRLQR
VTFLALHNYLGLTTELFNPESQAIPLVSVASVAAGKAKRQMFNGEDERLKKSLRPQESCD
SDHGGSRSVAALPLLKRSHSVPPPSVHKEILEELEEPRAGDPDPSALQGGPASFTSDLGM
ACDRARVFLHMDEHPGSSMLSKAKKNVIGAEMPPTVSHHSESHMDETLASSKSDAIFRAA
KKDLLTLMKLDDPSLLDGRVALLHVPAGTVVSKQGDQDASILFVVSGLLHVYQRKIGSQE
DTCLFLTRPGEMVGQLAVLTGEPLIFTIKANRDCGFLSISKAHFYEIMRKQPTVVLGVAH
TVVKRMSSFVRQIDFALDWVEVEAGRAIYRQGDRSDCTYIVLSGRLRSVIRKDDGKKRLA
GEYGRGDLVGVVETLTHQARATTVHAVRDSELAKLPAGALTSIKRRYPQVVTRLIHLLGE
KILGSLQQGPVTGHQFGLPTAGSKWDSGNPAVNLSTVAVMPVSEDVPLTTFTLELEHALS
AIGPTLLLTSDNIKQRLGPAALDSVHEYRLSSWLGQQEDTHRIVLYQADGSLTPWTQRCV
RQADCILIVGLGDQEPTVGELERMLESTAVRAQKQLVLLHREEGPAPARTVEWLNMRSWC
SGHLHLCCPRRVFSRRSLPKLVEMYKRIFQRPPDRHSDFSRLARVLTGNAIALVLGGGGA
RGCAQVGILKALAECGIPVDMVGGTSIGAFMGALYSEERNYSQMRIRAKQWAEGMTSMMK
AVLDLTYPVTSMFSGASFNSSICSVFQDRQIEDLWIPYFAITTDITASAMRVHTDGSLWR
YVRASMSLSGYMPPLCDPKDGHLLMDGGYINNLPADVARSMGAKVVIAIDVGSRDETDLT
NYGDSLSGWWLLWKRWNPLATKVKVLNMAEIQTRLAYVCCVRQLEVVKSSDYCEYLRPPI
DSYRTLDFGKFNEICEVGYQHGRMVFGIWGRSGVLEKMLRDQQGPSKRPASEVLTCPNAS
FTDLAEIVSRIEPAKAAVVDDESDYQTEYEEELLDVPRDAYADFQSTLAKQGSDSEDESS
LQPQHPSLDFPKWSEGSSDQDG
Download sequence
Identical sequences F6PZG7
ENSCJAP00000024627 XP_002806588.1.60252 ENSCJAP00000024627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]