SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024637 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000024637
Domain Number 1 Region: 287-375
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 2.75e-35
Family Small-conductance potassium channel 0.0000829
Further Details:      
 
Domain Number 2 Region: 189-332
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.03e-25
Family Voltage-gated potassium channels 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024637   Gene: ENSCJAG00000013407   Transcript: ENSCJAT00000026056
Sequence length 427
Comment pep:known chromosome:C_jacchus3.2.1:22:36086408:36102651:-1 gene:ENSCJAG00000013407 transcript:ENSCJAT00000026056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGDLVLGLGALRRRKHLLEQEKSLAGWALALAGIGIGLMVLHAEMLWFGGCSWALYLFL
VKCIISISTFLLLCLILAFHAKEVQLFMTDNGLRDWRVALTGRQAAQILLELAVCGLHPA
PVGGPPCAQGSGSPLTSLQPWPGFLSQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYR
SIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDT
LWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHN
FMMDIQYAKEMKESAARVLQEAWRFYKHTRRKESRAARRHQRRLLAAINAFRQVRLKHRK
LREQVNSMVDISKMQMILYDLQLNLSSSHRALEKQIDTLSGKLDTLTELLSTALGPRQLP
EPSQETT
Download sequence
Identical sequences F6PPT3
ENSCJAP00000024637 ENSCJAP00000024637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]