SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025441 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025441
Domain Number 1 Region: 400-509
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-25
Family PDZ domain 0.0023
Further Details:      
 
Domain Number 2 Region: 534-642
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-25
Family PDZ domain 0.0000599
Further Details:      
 
Domain Number 3 Region: 206-319
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000329
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025441   Gene: ENSCJAG00000013814   Transcript: ENSCJAT00000026888
Sequence length 1315
Comment pep:novel chromosome:C_jacchus3.2.1:7:31110729:31232614:-1 gene:ENSCJAG00000013814 transcript:ENSCJAT00000026888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQS
PEIFGSELATNSVSAFQPYQATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSISDNYF
SSEEPSRKNPTRWSTTAGFLKQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARS
SLSASHPMVGKWLEKQEQDEDGTEEDNSRVEPVGHADTGLENIPNFSLDDMVKLVQVPND
GGPLGIHVVPFSARGGRTLGLLVKRLEKGGKAEHENLFENDCIVRINDGDLRNRRFEQAQ
HMFRQAMRLPIIWFHVVPAANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHT
VQRAPRLNHPPEQIDSHSRLPHSVHPSGKLPSAPAPAPQNVFSTTISSGYNTKKIGKRLN
IQLKKGTEGLGFSITSRDITIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLAG
KSQEEVVSLLRSTKMEGTVSLLVFRQEDAFHPRELNAEPSQMQIPKETKTEDEDIVLTPD
GTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQ
LIAVNGESLLGKTNQDAMETLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPEL
PIETALDDRERRISHSLYSGIEGLDESPSRNAALSRIMGESGKYQLSPTVNMPQDDTVII
EDDRLPVLPPHLSDQSSSSSHDDVGFVTTDASTWAKAAISDSADCSLSPDVDPVLAFQRE
GFGRQSMSEKRTKQFSDASQLDFVKTRKSKSMDLGIADETKLSTVDDQKAGSPSRDVGPS
LGLKKSSSLESLQTAVAEVTLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDD
DEGMETLEEDTEESSRSGRESVSTASDQPSHSLERQMNGNQEKGDKTDRKKDKTGKEKKK
DRDKEKDKMKAKKGMLKGLGDMFRFGKHRKDDKIEKTGKIKIQESFTSEEERIRMKQEQE
RIQAKTREFRERQARERDYAEIQDFHRTFACDDELMYGGVSSYEGSMALNARPQSPREGH
LMDALYAQVKKPRNSKPSPVDSNRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQ
PWPNARPSAQSGRHSVSVEVQMQRQRQEERESSQQAQRQYSSLPRQSRKNASSVSQDSWE
QNYSPGEGFQSAKENPRYSSYQGSRNGYLGGHGFNARVMLETQELLRQEQRRKEQQMKKQ
APSEGPSNYDSYKKVQDPSYAPPKGPFRQDVPPSPSQVARLNRLQTPEKGRPFYS
Download sequence
Identical sequences F6WGS6
ENSCJAP00000025441 ENSCJAP00000025743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]