SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025453 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025453
Domain Number 1 Region: 310-418
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.03e-39
Family ets domain 0.00000495
Further Details:      
 
Domain Number 2 Region: 159-251
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.4e-28
Family Pointed domain 0.0000138
Further Details:      
 
Domain Number 3 Region: 38-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000278
Family Ubiquitin-related 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025453   Gene: ENSCJAG00000013817   Transcript: ENSCJAT00000026901
Sequence length 454
Comment pep:known chromosome:C_jacchus3.2.1:21:29687604:29734037:1 gene:ENSCJAG00000013817 transcript:ENSCJAT00000026901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKREAEELIEIEIDGTEKPECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQ
CSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTV
EVVIDPDAHHAESEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERL
GIPYDPIQWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEIL
WSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVQSATPTTIKVINSSAKAAKVQRAP
RISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKW
GQRKNKPTMNYEKLSRALRYYYDGDMICTAQGTTFVNEFLCDLKTLIVYNASHFNRLVTE
CEQKKLAKMPLHGIAQPVTAVALATASLQTEKDN
Download sequence
Identical sequences F6UV67
XP_002761373.1.60252 XP_008984767.1.60252 XP_017822643.1.60252 ENSCJAP00000025453 ENSCJAP00000025453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]