SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025730 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025730
Domain Number 1 Region: 9-198
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.12e-22
Family Ankyrin repeat 0.0022
Further Details:      
 
Domain Number 2 Region: 329-411
Classification Level Classification E-value
Superfamily RING/U-box 3.76e-20
Family RING finger domain, C3HC4 0.034
Further Details:      
 
Domain Number 3 Region: 511-561
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000141
Family RING finger domain, C3HC4 0.00094
Further Details:      
 
Domain Number 4 Region: 403-485
Classification Level Classification E-value
Superfamily RING/U-box 0.000000229
Family RING finger domain, C3HC4 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025730   Gene: ENSCJAG00000013964   Transcript: ENSCJAT00000027190
Sequence length 1090
Comment pep:known chromosome:C_jacchus3.2.1:8:55167082:55324328:-1 gene:ENSCJAG00000013964 transcript:ENSCJAT00000027190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNTTTKFRKALINGDENLACQIYENNPQLKESLDPNTSYGEPYQHNTPLHYAARHGMNK
ILGTFLCRDGNPNKRNVHNETSMHLLCMGPQIMISEGALHPRLARPTEDDFRRADCLQMI
LRWKGAKLDQGEYERAAIDAVDNKKNTPLHYAAASGMKACVELLVKHGGDLFAENENKDT
PCDCAEKQHHKDLALNLESQMVFSRDPEAEEIEAEYAALDKREPYEGLRPQDLRRLKDML
IVETADMLQAPLFTAEALLRAHDWDREKLLEAWMSNPENCCQRSGVQMPTPPPSGYNAWD
TLPSPRTPRTTRSSVTSPDEISLSPGDLDTSLCDICMCSISVFEDPVDMPCGHDFCRGCW
ESFLNLKIQEGEAHNIFCPAYDCFQLVPVDIIESVVSKEMDKRYLQFDIKAFVENNPAIK
WCPTPGCDRAVRLTKQGSNTSGSDTLSFPLLRAPAVDCGKGHLFCWECLGEAHEPCDCQT
WKNWLQKITEMKPEELVGVSEAYEDAANCLWLLTNSKPCANCKSPIQKNEGCNHMQCAKK
CKYDFCWICLEEWKKHSSSTGGYYRCTRYEVIQHVEEQSKEMTVEAEKKHKRFQELDRFM
HYYTRFKNHEHSYQLEQRLLKTAKEKMEQLSRALKETEGGCPDTTFIEDAVHVLLKTRRI
LKCSYPYGFFLEPKSTKKEIFELMQTDLEMVTEDLAQKVNRPYLRTPRHKIIKAACLVQQ
KRQEFLASVARGVAPADSPEAPRRSFAGGTWDWEYLGFASPEEYAEFQYRRRHRQRRRGD
VHSLLSNPPEPDEPSESTLDIPEGGSSSRRPGTSVVSSTSMSVLHSSSLRDYTPASRSEN
QDSLQALSSLDEDDPNILLAIQLSLQESGLAIDEETRDFLSNEASLGAIGTSLPSRLDSL
PRNTDSPRAALSSSELLELGDSLMRVGAESDPFSTDTLSSHPLSEARSDFCPSSSDPDSA
DQDPNINDNLLGNIMAWFHDMNPQSIALIPPATTEISADSQLPCIKDGSEGVKDVELVLP
EDSVFEDASGREGRGTQMEENRLEENILTEEAASQAGDSGNEAANRVDGSDVSSQTPQTS
SDWLEQVHLV
Download sequence
Identical sequences F6WAE3
ENSCJAP00000042530 ENSCJAP00000025730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]