SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025839 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025839
Domain Number 1 Region: 1087-1415
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.03e-83
Family Ankyrin repeat 0.00000734
Further Details:      
 
Domain Number 2 Region: 409-725
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.43e-82
Family Ankyrin repeat 0.00000757
Further Details:      
 
Domain Number 3 Region: 239-436
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.87e-51
Family Ankyrin repeat 0.00013
Further Details:      
 
Domain Number 4 Region: 1732-1802
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.24e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025839   Gene: ENSCJAG00000014029   Transcript: ENSCJAT00000027305
Sequence length 2609
Comment pep:novel chromosome:C_jacchus3.2.1:3:121605377:121629881:1 gene:ENSCJAG00000014029 transcript:ENSCJAT00000027305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKATVPVAAAAAAAAAAAAEREGSPPAVAAVAAPPAAAEVGGGVGGSSGARSASSPHGM
VRVCDLLLKKKPAQQQHHKAKRNRTCRPPSSSESSSDSDNSGGGGGGGGGGGGGGGTSSN
NSEEEEDDDDEEEEVSEVESFILDQDDLENPMLETASKLLLSGTADGADLRTVDPETQAR
LEALLEAAGIGKLSTADGKAFADPEVLRRLTSSVSCALDEAAAALTRMRAESTANAGQSD
NRSLAEACSEGDVNAVRKLLIEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVE
DRGIKGDITPLMAAANGGHVKIVKLLLAHKADVNAQSSTGNTALTYACAGGYVDVVKVLL
ESGASIEDHNENGHTPLMEAGSAGHVEVARLLLENGAGINTHSNEFKESALTLACYKGHL
EMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLA
ACGGHVELAALLIERGASLEEVNDEGYTPLMEAAREGHEEMVALLLGQGANINAQTEETQ
ETALTLACCGGFLEVADFLIKAGADIELGCSTPLMEAAQEGHLELVKYLLAAGANVHATT
ATGDTALTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGA
NVNRTTANNDHTVLSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTSVVC
YLLDYPNNLLSAPPPDVAQLTPPSHDLNRAPRVPVQALPMVVPPQEPDKPPANVATTLPI
RNKAASKQKSSSHLPANSQDVQGYITNQSPESIVEEAQGKLTELEQRIKEAIEKNAQLQS
LELAHADQLTKEKIEELNKTREEQIQKKQKILEELQKVERELQLKTQQQLKKQYLEVKAQ
RIQLQQQQQQSCQHLGLLTPVGVGEQLSEGDYARLQQVDPILLKDEPQQTAAQMGFAPIQ
PLAMPQALPLAAGPLPPGSIANLTELQGVIVGQPVLGQAQLAGLGQGILTETQQGLMVAS
PAQTLNDTLDDIMAAVSGRASAMSNTPTHSIAASISQPQTPTPSPIISPSAMLPIYPAID
IDAQTESNHDTALTLACAGGHEELVQTLLERGASIEHRDKKGFTPLILAATAGHVGVVEI
LLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLLARGANKEHRNVSDYTPLSLAASGG
YVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNT
ALTLACFQGRTEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAP
PVPSSRDTALTIAADKGHYKFCELLIGRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVQ
AGADVDAADNRKITPLMAAFRKGHVKVVRYLVKEVNQFPSDSECMRYIATITDKEMLKKC
HLCMESIVQAKDRQAAEANKNASILLEELDLEKLREESRRLALAAKREKRKEKRRKKKEE
QRRKLEEIEAKNKENFELQAAQEKEKLKVEDEPEVLTEPPSATTTTTIGISATWTTLAGS
HGKRNNTITTTSSKRKNRKNKITPENVQIIFDDPLPISYTQPEKVNGESKSSSTSESGDS
DNMRISSCSDESSNSNSSRKSDNHSPAVVTTTVSSKKQPSVLVTFPKEERKSVSGKASIK
LSETVNEGTSNSLSTCTKSGPSPLSSPNGKLTVASPKRGQKREEGWKEVVRRSKKVSVPS
TVISRVIGRGGCNINAIREFTGAHIDIDKQKDKTGDRIITIRGGTESTRQATQLINALIK
DPDKEIDELIPKNRLKSSSANSKIGSSAPTTTAANSSLMGIKMTTVALSSTSQTATALTV
PAISSASTHKTIKNPVNNVRPGFPVSLPLAYPPPQFAHALLAAQTFQQIRPPRLPMTHFG
GTFPPAQSTWGPFPVRPLSPARATNSPKPHMVPRHSNQNSSGSQVNSAGSLTSSPTTTTS
SSASTVPGTSTNGSPSSPSVRRQLFVTVVKTSNATTTTVTTTASNNSTAPTNATYPMPTA
KEHYPVSSPSSPSPPAQPGGVSRNSPLDCGSASPNKVASSSEQEAGSPPVVETTNTRPPN
SSSSSGSSSAHSNQQQPPGSVSQEPRPPLQQSQVPPPEVRMTVPPLATSSAPVAVPSTAP
VTYPMPQTQMGCPQPAPKMETPAIRPPPHGTTAPHKNSASVQNSSVAVLSVNHIKRPHSV
PSSVQLPSTLSTQSACQNSVHPANKPIAPNFSAPLPFGPFSTLFENSPTSAHAFWGGSVV
SSQSTPESMLSGKSSYLPNSDHLHQSDTSKAPGFRPPLQRPAPSPSGIVNMDSPYGSVTP
SSTHLGNFASNLSGGQMYGPGATLGGAPTAANFNRQHFSPLSLLTPCSSASNDSSAQSVS
SGVRAPSPAPSSVPLGSEKPSNVSQDRKVPVPIGTERSARIRQTGTSAPSVIGSNLSTSV
GHSGIWSFEGIGGNQDKVDWCNPGMGNPMIHRPMSDPGVFSQHQAMERDSTGIVTPSGTF
HQHVPAGYMDFPKVGGMPFSVYGNAMIPPVAPIPDGAGGPIFNGPHAADPSWNSLIKMVS
SSTENNGPQTVWTGPWAPHMNSVHMNQLG
Download sequence
Identical sequences F7IGM2
ENSCJAP00000026114 XP_002745784.1.60252 ENSCJAP00000025839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]