SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026361 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026361
Domain Number 1 Region: 277-465
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.17e-44
Family cAMP-binding domain 0.00016
Further Details:      
 
Domain Number 2 Region: 28-269
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.74e-31
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026361   Gene: ENSCJAG00000014312   Transcript: ENSCJAT00000027862
Sequence length 575
Comment pep:known chromosome:C_jacchus3.2.1:11:69574571:69579861:1 gene:ENSCJAG00000014312 transcript:ENSCJAT00000027862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQDTKVKTTESNPPATSKARKSLLVLDPSGDYYYWWLNTMVFPVMYNLIILVCRACFPD
LQHGYLGAWLVLDYTSDLLYLLDIVVRFHTGFLEQGILVVDKGRISSRYVRTWSFLLDLA
SLMPTDVVYLRLGPHTPTLRLNRFLRVPRLFEAFDRTETRTAYPNAFRIAKLMLYIFVVI
HWNSCLYFALSRYLGFGRDVWVYPDPAQPGFERLRRQYLYSFYFSTLILTTVGDTPPPAR
EEEYLFMAGDFLLAVMGFATIMGSMSSVIYNMNTADATFYPDHALVKKYMKLQHVNRKLE
RRVIDWYQHLQINKKMTNEVAILQHLPERLRAEVAVSVHMSTLSRVQIFQNCEASLLEEL
VLKLQPQTYSPGEYVCRKGDIGREMYIIREGQLAVVADDGITQYAVLGAGLYFGEISIIN
IKGNMSGNRRTANIKSLGYSDLFCLSKEDLKEVLSEYPQAQTVMEEKGREILLKMNKLDV
NAEAAEIALQEATESRLRGLDQQLDDLQTKFARLLAELESSALKIAYRVERLEWQTREWP
MPEDVVEADDEGEPGEGTSKDEEGRASQKGPPDLE
Download sequence
Identical sequences F7I9D4
ENSCJAP00000026361 ENSCJAP00000026361 XP_009005835.2.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]