SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026446 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026446
Domain Number 1 Region: 157-240
Classification Level Classification E-value
Superfamily E set domains 4.02e-20
Family E-set domains of sugar-utilizing enzymes 0.09
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000026446
Domain Number - Region: 247-297
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00752
Family HLH, helix-loop-helix DNA-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026446   Gene: ENSCJAG00000014357   Transcript: ENSCJAT00000027952
Sequence length 454
Comment pep:novel chromosome:C_jacchus3.2.1:12:117857562:117987644:-1 gene:ENSCJAG00000014357 transcript:ENSCJAT00000027952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPNNEKTNNGIHYKLQLLYSNGVRTEQDLYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTH
EIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVST
TVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEATPCIKAISPSEGWTTGGATVIIIGD
NFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYT
ALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALYGMPHNNQEIILKRAA
DIAEALYSVPRNHNQIPTLGNTPAHTGMMGVNSFSSQLAVNVSETSQASDQVGYSRNTSS
VSPRGYVPSSTPQQSNYNTVSTSMNGYGSGAMANLGVPGSPGFLNGSSANSPYGMKQKSA
FAPVVRPQASPPPSCTSANGNGLQAMSGLVVPPM
Download sequence
Identical sequences F7HQ55
ENSCJAP00000026446 ENSCJAP00000026459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]