SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026536 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026536
Domain Number 1 Region: 54-101
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000105
Family HLH, helix-loop-helix DNA-binding domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026536   Gene: ENSCJAG00000014432   Transcript: ENSCJAT00000028050
Sequence length 209
Comment pep:novel chromosome:C_jacchus3.2.1:3:188654117:188656530:1 gene:ENSCJAG00000014432 transcript:ENSCJAT00000028050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELNSLLILLEAAEYLERRERGSGGAPLCARGDGRAEPRPPPGACSRGPDSPSSHNELEK
HRRAKLRLYLEQLKQLVPLGPDSTRHTTLSLLKRAKVHIKEGIERAGHRCCGDRHRIGLG
VPEETCCKQGCPGEGASQSVRVQRDWTGRVGGRGRADHEVDIEGMEFGPGELDSVGSSDA
DDHYSLQSGSSSDSGFGPHCRRLGRPALL
Download sequence
Identical sequences F7IDZ7
ENSCJAP00000026544 ENSCJAP00000026536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]