SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027116 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027116
Domain Number 1 Region: 199-299
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.08e-28
Family Ras-binding domain, RBD 0.00000224
Further Details:      
 
Domain Number 2 Region: 4-105
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-24
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 3 Region: 334-439
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.2e-23
Family FHA domain 0.00000127
Further Details:      
 
Domain Number 4 Region: 936-1033
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-22
Family PDZ domain 0.0000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027116   Gene: ENSCJAG00000014702   Transcript: ENSCJAT00000028668
Sequence length 1750
Comment pep:novel chromosome:C_jacchus3.2.1:4:168901271:169002888:1 gene:ENSCJAG00000014702 transcript:ENSCJAT00000028668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYE
VHVSGEERRLDIDEKPLVVQLNWNKDDREGRFVLKNENDAIPPKKAQSNGPEKQEKEGVI
QNFKRTLALRQASDKDDRPFQGEDVENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQ
KLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLE
KENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPP
DHIPKKTKKHLEGKPPKGKEKADGSGYGSTLPPEKLPYLVELSPDGSDSRDKPKLYRLQL
SVTEVGTEKLDDNSIQLFGPGIQPHHCDLTNMDGVVTVTPRSIDAETYVEGQRISETTML
QSGMKVQFGASHVFKFVDPSQDHVLAKRSVDGGLMVKGPRHKPGIVQETTFDLGGDIHSG
TALPTSKSTTRLDSDRVSSASSTAERGMVKPMIRVEQQPDYRRQESRTQDASGPDLILPA
SIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSNQYRPDISPTERTHKV
IAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLAHLV
QMAFKYLVHCLQSELNNYMPAFLDDPEENSLQRPKIDDVLHTLTGAMSLLRRCRVNAALT
IQLFSQLFHFINMWLFNRLVTDPDSGLCSHYWGAIIRQQLGHIEAWAEKQGLELAADCHL
SRIVQATTLLTMDKYAPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIENVV
AVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVRNIPNGLQEFLDPLCQRG
FCRLIPHTRSPGTWTIYFEGADYESHLLRENTELAQPLRKEPEIITVTLKKQNGMGLSIV
AAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTSS
VVTLEVAKQGAIYHGLATLLNQPSPMMQRISDRRGSGKPRPKSEGFELYNNSAQNGSPES
PQLPWAEYSEPKKLPGDDRLMKNRADHRSSPNVANQPPSPGGKGAYASGTAAKITSVSTG
NLCTEEQSPPPRPEAYPIPTQTYTREYFTFPASKSQDRMAPPQNQWPNYEEKPHTHTDSN
HSSIAIQRVTRSQEELREDKTYQLERHRIEVALERKSDSDMWVNQSSSLDSSTSSQEHLN
HSSKPVTPASTLTKSGPGRWKTPAAIPATPVAVSQPLRTDLPPPPPPPPVHYAGDFDGMS
MDLPLPPPPSANQIGLPSAQVAAAERKKREEHQRWYEKEKARLEEERERKRREQERKLGQ
MRTQSLNPAPFSPLTTQQMKPEKPTTLQRPQETVIRELQPQQQPRTIERRDLQYITVSKE
ELSSGDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQSKPDRSAEESDRLRKLMLE
WQFQKRLTMLIMQRLEAERRARLQDEERRRQQQLEEMRKREAEDRARQEEERHRQEEERT
KRDAEEKRRQEEGYYSRLEAERRRQHDEAARRLLEPEAPGLCRPPLPQDYEPQSPSPTPS
APPPPPQRNASYLKTQVLSPDSLFTAKFVAYNEEEEEDCSLAGQDKYSSTRRFHGDLLPG
PHKPRPPPCQPRPASDGIFLSNSFQPPSAKANSTAHKKDQPPPPPKKSSFCHPSHCKGRG
KRVTNRLSLS
Download sequence
Identical sequences F7CWW2
ENSCJAP00000027116 ENSCJAP00000027122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]