SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027258 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027258
Domain Number 1 Region: 6-95
Classification Level Classification E-value
Superfamily PDZ domain-like 9.99e-29
Family PDZ domain 0.000013
Further Details:      
 
Domain Number 2 Region: 136-236
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-27
Family PDZ domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027258   Gene: ENSCJAG00000014794   Transcript: ENSCJAT00000028812
Sequence length 358
Comment pep:novel chromosome:C_jacchus3.2.1:5:123963230:123984134:1 gene:ENSCJAG00000014794 transcript:ENSCJAT00000028812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRSPTPSAWPRPRVCCLEKGPNGYGFHLHGEKGKVGQYIRLVEPGSPAEKAGLLAGDRLV
EVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQLQKLGVQVREELLRTQEAPGKA
ESPAAAEAQGAGNENEPSEADKSHPEQCELRPRLCTMKKGPNGYGFNLHSDKSKPGQFIR
SVDADSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDVTKLLVVDRETDEFFK
KCKVTPSQEHLNGPLPEPFTNGEIQKENSREALAEAALESPRPALVRTASSDTSEELNSQ
DSPPKQDSTVPSSTSSSDPILDFNISLAVAKERAHQKRSSKRAPQMDWSKKNELFSNF
Download sequence
Identical sequences F7FTV0
ENSCJAP00000027258 ENSCJAP00000027258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]