SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027408 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027408
Domain Number 1 Region: 277-471
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.84e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.000077
Further Details:      
 
Domain Number 2 Region: 2-114
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.28e-24
Family FCH domain 0.017
Further Details:      
 
Domain Number 3 Region: 519-583
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-16
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027408   Gene: ENSCJAG00000015927   Transcript: ENSCJAT00000028973
Sequence length 876
Comment pep:novel chromosome:C_jacchus3.2.1:15:60924961:60958296:-1 gene:ENSCJAG00000015927 transcript:ENSCJAT00000028973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRQAKYSENKLKCTKARNDYLLNLAATNAAISKYYIHDVSDLIDCCDLGFHASLARTFRT
YLSAEYNLETSRHEGLDVIENAVDNLDSRSDKHTVMDMCNQVFCPPLKFEFQPHMGDEVC
QVSAQQPVQTELLMRYHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQ
HSRSTESVKSAASETYMSKINIAKRRANQQETEMFYFTKFKEYVNGSNLITKLQAKHDLL
KQTLGEGERAECGTTRPPCLPPKPQKMRRPRPLSVYSHKLFNGSMEAFIKDSGQAIPLVV
ESCIRYINLYGLQQQGIFRVPGSQVEVNDIKNSFERGEDPLVDDQNERDINSVAGVLKLY
FRGLENPLFPKERFQDLISTIKLENPAERVHQIQQILVTLPRVVIVVMRYLFAFLNHLSQ
YSDENMMDPYNLAICFGPTLMHIPDGQDPVSCQAHINEVIKTIIIHHEAIFPSPRELEGP
VYEKCMAGGEEYCDSPHSEPGTIDEVDHDNGTEPHTSDEEVEQIEAIAKFDYMGRSPREL
SFKKGASLLLYHRASEDWWEGRHNGVDGLIPHQYIVVQDMDDAFSDSLSQKADSEASSGP
LLDDKASSKNDLQSPTEHISDYGFGGVMGRVRLRSDGAAIPRRRSGGDTHSPPRGLGPSI
DTPPRAAACPSSPHKIPLNRGRIESPEKRRMATFGSAGSINYPDKKALSEGHSMRSTCGS
TRHSSLGDHKSLEAEALAEDIEKTMSTALHELRELERQNTVKQAPDVVLDTLEPLKNPPG
PISSEPASPLHTIVIRDPDAAMRRSSSSSTEMMTTFKPALSARLAGAQLRPPPMRPVRPV
VQHRSSSSSSSGVGSPAVTPTEKMFPNSSADKSGTM
Download sequence
Identical sequences F7IA52
ENSCJAP00000029347 ENSCJAP00000027408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]