SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027414 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027414
Domain Number 1 Region: 24-186,213-337
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.6e-63
Family FCH domain 0.0022
Further Details:      
 
Domain Number 2 Region: 499-694
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.0000643
Further Details:      
 
Domain Number 3 Region: 743-805
Classification Level Classification E-value
Superfamily SH3-domain 8.81e-16
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027414   Gene: ENSCJAG00000014842   Transcript: ENSCJAT00000028980
Sequence length 1085
Comment pep:known chromosome:C_jacchus3.2.1:9:52888293:53228069:1 gene:ENSCJAG00000014842 transcript:ENSCJAT00000028980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTPSRFKKDKEIIAEYESQVKEIRAQLVEQQKCLEQQTEMRVQLLQDLQDFFRKKAEIE
TEYSRNLEKLAERFMAKTRSTKDHQQYKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDI
YLNNVIMRFMQISEDSTRMFKKSKEIAFQLHEDLMKVLNELYTVMKTYHMYHAESISAES
KLKEAEKQEEKQIGRSGDPVFHIRLEERHQRRSSVKKIEKMKEKRQAKYSENKLKSIKAR
NEYLLTLEATNASVFKYYIHDLSDLIDCCDLGYHASLNRALRTYLSAEYNLETSRHEGLD
IIENAVDNLEPRSDKQRFMEMYPAAFCPPMKFEFQSHMGDEVCQVSAQQPVQAELMLRYQ
QLQSRLATLKIENEEVKKTTEATLQTIQDMVTIEDYDVSECFQHSRSTESVKSTVSETYL
SKPSIAKRRANQQETEQFYFMKLREYLEGSNLITKLQAKHDLLQRTLGEGHRAEYMTTRP
PNVPPKPQKHRKSRPRSQYNTKLFNGDLETFVKDSGQVIPLIVESCIRFINLYGLQHQGI
FRVSGSQVEVNDIKNSFERGENPLADDQSNHDINSVAGVLKLYFRGLENPLFPKERFNDL
ISCIRIDNLYERALHIRKLLLTLPRSILIVMRYLFAFLNHLSQYSDENMMDPYNLAICFG
PTLMPVPEVQDQVSCQAHVNEIIKTIIIHHETIFPDAKELDGPVYEKCMAGDDYCDSPYS
EHGTLEEVDQDAGTEPHTSEDECEPIEAIAKFDYVGRSARELSFKKGASLLLYHRASEDW
WEGRHNGIDGLVPHQYIVVQDMDDTFSDTLSQKADSEASSGPVTEDKSSSKDMNSPTDRH
PDGYLARQRKRGEPPPPVRRPGRTSDSHCPLHPPHALSNSSVDLGSPSLASHPRGLLQNR
GLNNDSPERRRRPGHGSLTNISRHDSLKKNDSPPIRRSTSSGQYTGFNDHKPLDPETIAQ
DIEETMNTALNELRELERQSTAKHAPDVVLDTLEQVKNSPTPATSTESLSPLHNVALRSS
EPQIRRSTSSSSDTMSTFKPMVAPRMGVQLKPPALRPKPAVLPKTNPTIGPAPPSQGPTD
KSCTM
Download sequence
Identical sequences F7GUM9
XP_002752743.1.60252 ENSCJAP00000027414 ENSCJAP00000027414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]