SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027608 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027608
Domain Number 1 Region: 24-304
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.48e-57
Family FCH domain 0.0039
Further Details:      
 
Domain Number 2 Region: 592-675
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-20
Family SH3-domain 0.00069
Further Details:      
 
Domain Number 3 Region: 495-562
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000119
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027608   Gene: ENSCJAG00000014990   Transcript: ENSCJAT00000029179
Sequence length 764
Comment pep:known chromosome:C_jacchus3.2.1:11:65648332:65977865:1 gene:ENSCJAG00000014990 transcript:ENSCJAT00000029179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPPRKVKVTQELKNIQAEQMTKLQAKHQAECDLLEDMRTFSQKKAAIEREYAQGIQKL
ASQYLKRDWPGVKADDRNDYRSMYPVWKSFLEGTMQVAQSRMNICENYKNFISEPARTVR
SLKEQQLKRCVDQLTKIQTELQETVKDLAKGKKKYFETEQMAHAVREKADIEAKSKLSLF
QSRISLQKASVKLKARRSECNSKATHARNDYLLTLAAANAHQDRYYQTDLVNIMKALDGN
VYDHLKDYLITFSRTELETCQAVQNTFQFLLENSSKVVRDYNLQLFLQENAVFHKPQPFQ
FQPCDSDTSLKAAQLVDIELSPVSALRMTIAESRQLESETGTTEEHSLNKEARKWATRVA
REHKNIVHQQRVLNDLECHGVAVSEQSRAELEQKIDEARENIRKAEIIKLKAEARLDLLK
QIGVSVDTWLKSAMNQVMEELENERWARPPAVTSNGTLHSLNADTEREEGEEFEDNMDVF
DDSNSSPSGTLRNYPLTCKVVYSYKASQPDELTIEEHEVLEVIEDGDMEDWVKARNKVGQ
VGYVPEKYLQFPTSNSLLSMLQSLAALDSRSHTSSNSTEAELVSGSLNGDASVCFVKALY
EYEGQTDDELSFPEGAIIRILNKENQDDDGFWEGEFSGRIGVFPSVLVEELSASENGDTP
WMREIQISPSPKPHASLPPLPLYDQPPSSPYPSPDKRSSLYFPRSPSANENSLHAESPGF
SQASRHTPETSYGKLRPVRAAPPPPTQNHRRPAEKIEDVEITLV
Download sequence
Identical sequences F6TPZ1
ENSCJAP00000045702 ENSCJAP00000027608 XP_017833300.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]