SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028150 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028150
Domain Number 1 Region: 17-305
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.77e-74
Family FCH domain 0.0014
Further Details:      
 
Domain Number 2 Region: 382-443
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-19
Family SH3-domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028150   Gene: ENSCJAG00000015266   Transcript: ENSCJAT00000029749
Sequence length 444
Comment pep:novel chromosome:C_jacchus3.2.1:4:35401828:35422417:1 gene:ENSCJAG00000015266 transcript:ENSCJAT00000029749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSYDEASLAPEETTDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYAQQL
TDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDA
YHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELETAKKAYHLACKEEKMAMTREMNSKTE
QSVTPEQQKKLQDKVDKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEK
RLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWP
QFEEWNPDLPHTTTKKEKQPKKAEGVALSNATGAVESTSQAGDRGSVSSYDRGQPYATEW
SDDESGNPFGGSEANGGANPFEDDSKGVRVRALYDYDGQEQDELSFKAGDELTKLGEEDE
QGWCRGRLDSGQLGLYPANYVEAI
Download sequence
Identical sequences F6UQ67
ENSCJAP00000028150 ENSCJAP00000049922 XP_002746499.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]