SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000029009 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000029009
Domain Number 1 Region: 11-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.55e-78
Family BAR domain 0.0000000521
Further Details:      
 
Domain Number 2 Region: 284-344
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-21
Family SH3-domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000029009   Gene: ENSCJAG00000015730   Transcript: ENSCJAT00000030653
Sequence length 347
Comment pep:known chromosome:C_jacchus3.2.1:6:23135656:23288586:1 gene:ENSCJAG00000015730 transcript:ENSCJAT00000030653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKAVAEILSKTTEYLQP
NPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALMEVGES
MKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPD
EEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHKQSTEILQELQSKL
QMRISAASSVPRREYKPRPVKRSSSEFNGVSTTSVAKTTGSNVPMDQPCCRGLYDFEPEN
QGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ
Download sequence
Identical sequences F7HYN2
ENSCJAP00000029009 XP_002749231.1.60252 ENSCJAP00000029009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]