SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000029172 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000029172
Domain Number 1 Region: 49-124
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000471
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 139-181
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000144
Family Hairy Orange domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000029172   Gene: ENSCJAG00000015832   Transcript: ENSCJAT00000030825
Sequence length 412
Comment pep:known chromosome:C_jacchus3.2.1:15:56837806:56843537:1 gene:ENSCJAG00000015832 transcript:ENSCJAT00000030825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERIPSAQPPPACLPKAPGLEHGDLPGMDFAHMYQVYKSRRGIKRSEDSKETYKLPHRLI
EKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIA
LQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVS
ELLQGGTSRKPSDPAPKVMDFKEKPSSLAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTD
TDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERVSAIKQESEEPPTKKNRMQLSDDEGH
FTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAA
ALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKQIPPLNLETKD
Download sequence
Identical sequences F7I5L6
XP_002758633.1.60252 ENSCJAP00000029172 ENSCJAP00000029172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]