SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000029370 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000029370
Domain Number 1 Region: 521-752
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 5.62e-20
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.044
Further Details:      
 
Domain Number 2 Region: 16-66
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000179
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 163-220
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000252
Family B-box zinc-binding domain 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000029370
Domain Number - Region: 230-296
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.085
Family Apolipoprotein A-I 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000029370   Gene: ENSCJAG00000015951   Transcript: ENSCJAT00000031035
Sequence length 755
Comment pep:known chromosome:C_jacchus3.2.1:2:10956337:10958604:-1 gene:ENSCJAG00000015951 transcript:ENSCJAT00000031035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSHGSSPSLLEALSSDFLACKICLEQLRAPKTLPCLHTYCQDCLAQLADGGHVRCPECR
ETVPVPPEGVAAFKTNFFVNGLLDLVKARACGDLRAGKPACALCPLVGGTSAGGPATARC
LDCADDLCQACADGHRCTRQTHSHRVVDLVGYRAGWYDEEARERQAAQCPQHPGEALRFL
CQPCSQLLCRECRLDPHLDHPCLPLAEAVRARRPGLEELLAGVDSNLLELEAERRVEKEA
LTRLREQAARVGTQVEEAAEGVLRALLAQKQEVLGRLRAHVEAAEEAARERLAELESREQ
VARAAAAFARRVLSLGREAEILSLEGAIAQRLRQLQGCPSARGPAPCLIPQLELHPGLLD
KNCHLLRLSFEEQQPQKDGGKNGAGTQGSEESQSRREDAMKTERQGGTQLQARDEAQTPR
EDKAQMPREDGAQTLEEDRAQMPREDGGPQSQRGGRSNKKRKFKGRLKSISREPSPALGP
NLDGSGLLPRPIFSCSFPTRMPGDKRSPRITGLCPFGPREILVADEQNRVLKRFSLNGDY
KGTVPVPEGCSPCSVAALQSAVAFSAGARLYLISPDGEVQWRRALSLSQASHAVAALPSG
DRVAVSVAGHVEVYNMEGSLATRFIPGGKASRGLRALVFLTTSPQGHFVGSDWQQNSVVI
CDGLGQVVGEYKGPGLHGCQPGSVSVDKKGYIFLTIREVNKVVILDPKGSLLGDFLTAYH
GLEKPRVTTMVDGRYLVVSLSNGTIHVFRVRSSDS
Download sequence
Identical sequences F7I5G2
XP_002744018.1.60252 XP_008980426.1.60252 ENSCJAP00000029370 ENSCJAP00000029370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]