SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000029910 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000029910
Domain Number 1 Region: 18-109
Classification Level Classification E-value
Superfamily WWE domain 6.93e-24
Family WWE domain 0.0013
Further Details:      
 
Domain Number 2 Region: 107-183
Classification Level Classification E-value
Superfamily WWE domain 9.81e-24
Family WWE domain 0.00097
Further Details:      
 
Domain Number 3 Region: 392-494
Classification Level Classification E-value
Superfamily RING/U-box 9.96e-20
Family RING finger domain, C3HC4 0.00000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000029910   Gene: ENSCJAG00000016235   Transcript: ENSCJAT00000031606
Sequence length 621
Comment pep:known chromosome:C_jacchus3.2.1:2:9420872:9452017:1 gene:ENSCJAG00000016235 transcript:ENSCJAT00000031606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMAPGPSLVQVYTGPVAVAVWEWQDGLGTWHPYSAAVCSFIEQQFVQQKGQRFGLGSLA
HSIPLGQADPSLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQHSAPGRGVVWEWLSDDGS
WTAYEASVCDYLEQQVARGNQLVDLAPLGYNYTVNYTTHTQTNKTSSFCRSVRRQAGPPY
PVTTIIAPPGHTGVACSCHQCLSGSGTGPVSGRYRHSMTSLPAYPAPQHHPHRTTFAFGT
HQAFTPYNKPSLSGARSAPRLNTTSPWSAAPPSLGSQPLYRSSLSHLGPQFLPPGSSTSS
AVSFSFPSGPLSSSGSVPATVPVQMPKPSRVQQALAAGMTSVLMSAIGLPVCLSRAPQPA
SPPASRLASKSHSSVKRLRKMSVKGGTPKPEPEQVIKNYTEELKLLPDEDCIICMEKLSA
VSGYSDMTDSKAIGPLAVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTG
TQPQGKMEVLRFQTSLPGHEDCGTILIVYNIPHGIQGPEHPNPGKPFTARGFPRQCYLPD
NAQGRKVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMDRNVTGHGYPDPNY
LQNVLAELAAQGVTEDCLEQQ
Download sequence
Identical sequences F6Z345
ENSCJAP00000051181 ENSCJAP00000029910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]