SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000029927 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000029927
Domain Number 1 Region: 269-412
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.75e-33
Family cAMP-binding domain 0.00000021
Further Details:      
 
Domain Number 2 Region: 135-266
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.68e-33
Family cAMP-binding domain 0.000000174
Further Details:      
 
Domain Number 3 Region: 2-43
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000719
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000029927   Gene: ENSCJAG00000016244   Transcript: ENSCJAT00000031625
Sequence length 418
Comment pep:novel chromosome:C_jacchus3.2.1:8:75620908:75728478:1 gene:ENSCJAG00000016244 transcript:ENSCJAT00000031625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFSHEGRTWGD
TGAAAGGGTPSKGVNFAEEPMHSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAY
NPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEH
VIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATS
PGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDG
EQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENDAVEIARCSRGQYFGELALVTNKP
RAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA
Download sequence
Identical sequences F7ADV3
ENSCJAP00000029927 ENSCJAP00000049624 XP_002751774.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]