SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030198 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030198
Domain Number 1 Region: 1-287
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.85e-77
Family FCH domain 0.000000000115
Further Details:      
 
Domain Number 2 Region: 542-598
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000131
Family SH3-domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000030198
Domain Number - Region: 397-466
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 0.000235
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030198   Gene: ENSCJAG00000016334   Transcript: ENSCJAT00000031909
Sequence length 601
Comment pep:known chromosome:C_jacchus3.2.1:22:6447126:6461785:1 gene:ENSCJAG00000016334 transcript:ENSCJAT00000031909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWGTELWDQFEVLERHTQWGLDLLERYVKFVKERTEVEQAYAKQLRNLVKKYLPKRPAK
DDPESRFSQQQSFVQILQEVNDFAGQRELVAENLSVRVCLELTKYSQEMKQERKMHFQEG
RRAQQQLENGFKQLENSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHLRS
HMAEESKNEYAAQLQRFNRDQAHFYFSQMPQIFDKLQDMDERRAIRLGAGYGLLSEAELE
VVPIIAKCLEGMKVAAHAVDPKNDSQVLIELHKSGFARPGDVEFEDFSQPMNRAPSDSSL
GTPSEGRPELRGPGRSRAKRWPFGKKNKPRPPPLSPLGGPIPLALPNGPPSPRSGRDPLT
ILSEISKSVKPRLASFRSLRGSRGTVVTEDFSHLPPEQQRKRLQQQLEERNRELQKEVDQ
REALKKMKDVYEKTPQMGDPASLEPQITETLGNIERLKLEVQKYEAWLAEAESRVLSNRG
DSLSRHARPPDPPTSAPPDNSSNSGSQDTKESSEEPPSEESQDTPIYTEFDEDFEEEATS
PIGHCVAIYHFEGSSEGTISMAEGEDLSLMEEDKGDGWTRVRRKEGGEGYVPTSYLRVTL
N
Download sequence
Identical sequences F7BSL7
ENSCJAP00000030198 ENSCJAP00000030205 XP_002761686.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]