SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030583 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030583
Domain Number 1 Region: 1044-1092
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 2.16e-17
Family Nuclear receptor coactivator interlocking domain 0.0001
Further Details:      
 
Domain Number 2 Region: 264-369
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.03e-16
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.001
Further Details:      
 
Domain Number 3 Region: 121-185
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000655
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.044
Further Details:      
 
Domain Number 4 Region: 34-91
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000363
Family HLH, helix-loop-helix DNA-binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030583   Gene: ENSCJAG00000016602   Transcript: ENSCJAT00000032318
Sequence length 1418
Comment pep:novel chromosome:C_jacchus3.2.1:5:41714261:41721109:1 gene:ENSCJAG00000016602 transcript:ENSCJAT00000032318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLGENLDPLATDSRKRKLPCDTPGQGLICSGEKRRREQESKYIEELAELISANLSDID
NFNVKPDKCVILKETVRQIRQIKEQGKTISSDDDVQKADVSSTGQGVIDKDSLGPLLLQA
LDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVNG
VSWTNETQRQKSHTFNCRMLMKTHDILEDINTGPEMRQRYETMQCFALSQPRAMMEEGED
LQSCMICVARRITTGERVYPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRCI
QRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDRH
GFVSTHFLQREQNGYRTNPNPVGQGIRPPMAGCNSSVGGMSMSPNQGLQMPSSRAYGLAD
PSTTGQMSGARYGGSSNIASVTSGPGMQSPSSYQNNNYGLNMSSPPHGSPGLAPNQQNIM
ISPRNRGSPKMASHQFSPVAGVHSPMGSSGNTGSHSFSSSSLSALQAISEGVGTSLLSTL
SSPGPKLDNSPNMNITQPSKVSSQDSKSPLGFYCDQNPVESSMCQSNSRDHLGDKENKES
SVEGSENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSNCKESSVSVTSPSGVSS
STSGGVSSTSSMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSITSCGDGNV
VKQEQLSPKKKENNALLRYLLDRDDPSDALSKELQPQVEGVDNKMSQCTSSTIPSSSQEK
DPKIKTETSEEGSGDLDNLDAILGDLTSSDFYNNSVSTNGSHLGTKQQMFQGTNSLGLKN
PQSVQSVRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYGSS
MGGPNRNVTVTQTPSSGDWGLPNSKASRMEPMNSNSMGRPGGDYNTSLPRAALGGSVPTL
PLRSNSIPGVRPMLQPQQQQQQMLQMRPGEIPMGMGANPYGQAASSNQLGSWSDGMLSME
QVPHGTQNRPLLRNSLDDLVGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRALGI
PELVNQGQALEPKQDAFQGQEAAVMMDQKPGLYGQTYPAQGPPMQGGFHLQGQSPSFNSM
MNQMNQQGNFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALELKMENP
TAGGAAVMRPMMQPQVSSQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQQQQQQ
QQQQQQQQQQTQAFSPPPNVTASPSMDGLLAGPAMPQAPPQQFTYQPNYGMGQQPDPAFG
RVSSPPNAMMSSRMGPSQNPMMQHPQAASMYQSSEMKGWPSGSLARNSSFSQQQFAHQGN
PAMYSMVHVNGSSSHMGPMNMNPMPMSGMPMGPDQKYC
Download sequence
Identical sequences F6Y438
XP_002747674.2.60252 ENSCJAP00000030711 ENSCJAP00000030583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]