SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030665 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030665
Domain Number 1 Region: 156-236
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.37e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.000033
Further Details:      
 
Domain Number 2 Region: 67-141
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.84e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000705
Further Details:      
 
Domain Number 3 Region: 247-333
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.11e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000464
Further Details:      
 
Domain Number 4 Region: 348-420
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.47e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030665   Gene: ENSCJAG00000016627   Transcript: ENSCJAT00000032404
Sequence length 633
Comment pep:novel chromosome:C_jacchus3.2.1:22:6146245:6156585:-1 gene:ENSCJAG00000016627 transcript:ENSCJAT00000032404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILRAKEIAAKIGGDAATTVNNSTPDFGFGGQKRQLEDGDQPESKKLASQGDSISSQLGPI
HPPPRTSMTEEYRPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAP
ESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIMIPAGKAGLVIGKGGETIKQ
LQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVMDILRERDQGGFGDRNEYG
SRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDR
CEHAARIINDLLQSLRSGPPGPPGGPGMPPGGRGRGRGQGNWGPPGGEMTFSIPTHKCGL
VIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFIIRGSPQQIDHAKQLIEEKIEGP
LCPVGPGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPPHQYPPQGWGNTYPQWQPPA
PHDPSKAAAAAADPNAAWAAYYSHYYQQPPGPVPGPAPAPAAPPAQGEPPQPPPTGQSDY
TKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYSAAW
AEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQAQ
Download sequence
Identical sequences F7A6N6
ENSCJAP00000030665 ENSCJAP00000030665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]