SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030685 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030685
Domain Number 1 Region: 509-710
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-23
Family SPRY domain 0.0057
Further Details:      
 
Domain Number 2 Region: 204-267
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.29e-16
Family B-box zinc-binding domain 0.00098
Further Details:      
 
Domain Number 3 Region: 431-514
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000524
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 4 Region: 25-64
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000109
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000030685
Domain Number - Region: 251-341
Classification Level Classification E-value
Superfamily Prefoldin 0.034
Family Prefoldin 0.01
Further Details:      
 
Domain Number - Region: 149-199
Classification Level Classification E-value
Superfamily RING/U-box 0.0459
Family ZZ domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030685   Gene: ENSCJAG00000016675   Transcript: ENSCJAT00000032425
Sequence length 729
Comment pep:novel chromosome:C_jacchus3.2.1:2:91641733:91644654:1 gene:ENSCJAG00000016675 transcript:ENSCJAT00000032425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESGEMSEFGYIMELLAKGKVTIKNIERELICPACKELFTHPLILPCQHSICHKCVKEL
LLTLDDSFNDVGSDNSNQSSPRLRLSSPSMDKIDRINRPGWKRNSLTPRTTVFPCPGCEH
DVDLGERGINGLFRNFTLETIVERYRQAARAATAIMCDLCKPPPQESTKSCMDCSASYCN
ECFKIYHPWGTVKAQHEYVGPTTNFRPKILMCPEHETERINMYCELCRRPVCHLCKLGGN
HSNHRVTTMSSAYKTLKEKLSKDIDYLIGKESQVKSQISELNLLMKETECNGERAKEEAI
THFEKLFEILEERKSSVLKAIDSSKKLRLDKFQTQMEEYQGLLENNGLVGYAQEVLKETD
QSCFVQTAKQLHLRIQKATESLKSFRPAAQTSFEDYVVNTSKQTELLGELSFFSSGIDVP
EINEEQSKVYNNALINWHHPEKDKADSYVLEYRKINRDDEMLSWNEAEVCGTSKIIQDLE
NSSTYAFRVRAYKGSICSPCSRELILHTPPAPVFSFLFDEKCGYNNEHLLLNLKRDRVES
RAGYNLLLAAERIQVGYYTSLDYIIGDTGITKGKHFWAFRVEPYSYLVKVGVASSDKLQE
WLRSPRDAVSPRYEQDSGHDSGSEDACFDSSQPFTLVTIGMKKFFIPKSPTSSNDPENRV
LPMPTSIGIFLDYDKGKVSFYDMDHMKCLYERQVDCSHTLYPAFALMGSGGIQLEEPITA
KYLEYQENM
Download sequence
Identical sequences F6Y3Q5
ENSCJAP00000030719 XP_002744745.1.60252 ENSCJAP00000030685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]