SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030726 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030726
Domain Number 1 Region: 401-533
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.1e-32
Family DEP domain 0.0000222
Further Details:      
 
Domain Number 2 Region: 12-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.76e-24
Family DIX domain 0.0019
Further Details:      
 
Domain Number 3 Region: 237-341
Classification Level Classification E-value
Superfamily PDZ domain-like 5.46e-22
Family PDZ domain 0.0000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030726   Gene: ENSCJAG00000016678   Transcript: ENSCJAT00000032472
Sequence length 719
Comment pep:known chromosome:C_jacchus3.2.1:5:74637760:74648752:1 gene:ENSCJAG00000016678 transcript:ENSCJAT00000032472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPAHEPRTELAPPAPPLPPL
PPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRERPRRRDSSEHGAGGHRTS
GPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQSSASRLLKRHRNVK
DFTMYVNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDML
LQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAYFTLPRNEPIQPIDPA
AWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSIHTDMASVTKAMAAPESGL
EVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAGLIRHTVNKITF
SEQCYYIFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLPGAAPWPLLPTFSYQYPA
PHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGGAGRTGRPEERAPESKSG
SGSESEPSSRGGSLRWGGEPSGTGDGGPPSSRGSSGGAPNLRAHPGLHPYGPPPGMALPY
NPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQSFHMAMGNPSEFFVDVM
Download sequence
Identical sequences F6Y338
ENSCJAP00000030726 ENSCJAP00000030726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]