SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030770 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030770
Domain Number 1 Region: 39-265
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.11e-45
Family Ankyrin repeat 0.00027
Further Details:      
 
Domain Number 2 Region: 497-593
Classification Level Classification E-value
Superfamily PDZ domain-like 6.44e-18
Family PDZ domain 0.0000203
Further Details:      
 
Domain Number 3 Region: 430-465
Classification Level Classification E-value
Superfamily SH3-domain 0.000000024
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030770   Gene: ENSCJAG00000035044   Transcript: ENSCJAT00000032516
Sequence length 636
Comment pep:novel chromosome:C_jacchus3.2.1:1:210221679:210249675:1 gene:ENSCJAG00000035044 transcript:ENSCJAT00000032516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSWDEGVFSTFSLSEQFRYKRRVYAQNLIDDKQFAKLHTKANLKKFMDYVQLHSTDKVAR
LLDKGLDPNFHDPDSGECPLSLAAQLDNATDLLKVLKNGGAHLDFRTRDGLTAVHCATRQ
RNAAALTTLLDLGASPDYKDSRGLTPLYHSALGGGDALCCELLLHDHAQLGTTDENGWQE
IHQACRFGHVQHLEHLLFYGADMGAQNASGNTALHICALYNQESCARVLLFRGANRDVRN
YNSQTAFQVAIIAGNFELAEVIKTHKDSDVVPFRETPSYAKRRRLAGPSGLASPRPLQRS
ASDINLKGEAQPAASPGPSLRSLPHQLLLQRLQEEKDRDRDADQESNISGPLVGRGSQSK
IRTRGHSPGGGRGAPSPSSRVPKPPPRPRSPQAAQTPVPHPVGTPPPGGRRRGEGARAAA
SRRGRIPATEVLSIGEGGFWEGTVKGRTGWFPADCVEEVQMRQHDTRPETREDRTKRLFR
HYTVGSYDSLTSHSDYVIDDKVAVLQKRDHEGFGFVLRGAKAETPIEEFTPTPAFPALQY
LESVDVEGVAWRAGLRTGDFLIEVNGVNVVKVGHKQVVALIRQGGNRLVMKVVSVTRKPE
EDGARRRAPPPPKRAPSTTLTLRSKSMTAELEELGK
Download sequence
Identical sequences F6VNL1
ENSCJAP00000030770 ENSCJAP00000030770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]