SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030776 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030776
Domain Number 1 Region: 176-401
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.14e-46
Family Ankyrin repeat 0.00036
Further Details:      
 
Domain Number 2 Region: 657-753
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-20
Family PDZ domain 0.00000483
Further Details:      
 
Domain Number 3 Region: 539-615
Classification Level Classification E-value
Superfamily SH3-domain 7.74e-19
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030776   Gene: ENSCJAG00000016713   Transcript: ENSCJAT00000032524
Sequence length 959
Comment pep:known chromosome:C_jacchus3.2.1:22:42495573:42548296:-1 gene:ENSCJAG00000016713 transcript:ENSCJAT00000032524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHSPATSEDEERHSASECPEGGSESDSSPDGPGQGPRGARGRGSGAPGSLASVRGLQGR
SMSVPDDAHFSMMVFRIGIPDLHQTKCLRFNPDATIWTAKQQVLCALSESLQDVLNYGLF
QPATSGRDANFLEEERLLREYPQSFEKGVPYLEFRYKTRVYKQTNLDEKQLAKLHTKTGL
KKFLEYVQLGTSDKVARLLDKGDPNYHDSDSGETPLTLAAQTEGSVEVIRTLCLGGAHID
FRARDGMTALHKAACARHCLALTALLDLGGSPNYKDRRGLTPLFHTAMVGGDPRCCELLL
YNRAQLGIADENGWQEIHQACQRGHSQHLEHLLFYGAEPGAQNASGNTALHICALYNKET
CARILLYRGADKDVKNNNGQTPFQVAVIAGNFELGELIRNHREQDVVPFQESPKYAARRR
GPPGTGLTVPPALLRANSDTSMALPDWMVFSAPGASSSGAPGPTSGSQGQSQPSAPTTKL
SSGTLRSASSPRGARARSPSRGRHPEDAKRQPRGRPSSSGTPREGPAGGTGGSGGPGGSL
GSRGRRRKLYSAVPGRSFMAVKSYQAQAEGEISLSKGEKIKVLSIGEGGFWEGQVKGRVG
WFPSDCLEEVANRSQESKQESRSDKAKRLFRHYTVGSYDSFDAPSLIDGIGPGSDYIIKE
KTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGDF
LIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDMDEAVHKKAPQQAKRLPPPT
ISLRSKSMTSELEEMVSPWKKKSEYEQQPAPVPSMEKKRTVYQMALNKLDEILAAAQQTI
SASESPGPGGLASLGKHRPKGFFATESSFDPHHRSQPSYERPSFLPPGPGLMLRQKSIGA
AEDDRPYLAPPAMKFSRSLSVPGSEDIPPPPTTSPPEPPYSTPPAPSSSGRLTPSPRGG
Download sequence
Identical sequences F6VNC8
ENSCJAP00000030776 ENSCJAP00000030776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]