SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030962 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030962
Domain Number 1 Region: 644-729
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.24e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030962   Gene: ENSCJAG00000016824   Transcript: ENSCJAT00000032719
Sequence length 848
Comment pep:novel chromosome:C_jacchus3.2.1:2:8171494:8203184:1 gene:ENSCJAG00000016824 transcript:ENSCJAT00000032719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGALAGLAAGLQVPRVVPSPDSDSDTDSEDPSLRRGAGGLLRSQVIHSGHFMVSSPHSD
SLPRRRDQEGSVGLSDFGPRSIDPTLTRLFECLSLAYSGKLVSPKWKNFKGLKLLCRDKI
RLNNAIWRAWYIQYVERRKSPVCGFVTPLQGPEADAHRKPEAVVLEGNYFQRRIEVVMRE
YHRWRIYYKNPLRKSSREEDLLAPKQSEGEWPPPEQWCRQLFSSVVPVLLGDPEQEPGGR
QLLDLDCFLSDISDTLFTMTQPGPSPLQLPPEDGRYLGSACIIQAPRRQKCPGSSPAWEG
SGPIWAHRPPPQVGAQPPQPGVWARPEGTGARRLGSNFSQGSVGTTMLSSDGAADTQGAD
RCADPTLRLQDSATAPTGPAHSQKAEPLVTLHLLTFQQTKLVPEPMTSCPLSSPTHPLNF
CHPGAHPIPDLPPPCTNRTPFPPGELSLGTPFLYLQQIREGEPPGDREGPCSHPQSPAIP
TPLNPPKTVAASLETETLPVSQSPVEGTPTSHPLAPRSPPAKAGDRPLSSQLFPSHSPGP
NCYCSVYFFTNSRPPQTPMTSNFPEPSSFSPVADSLFSSGTLDPEVPPTSTGIPSADLSV
PPTGSERRLSGDLSSMPGPGTLSVRVSPPQATLSRGRPDSNKTENRRITHISAEQKRRFN
IKLGFDTLHGLVSTLSAQPSLKVSKATTLQKTAEYILMLQQERASLQEEAQQLRDEIEEL
NAAINLCQQQLPATGVPITHQRFDQMRDMFDDYVRTRTLHNWKFWVFSILIRPLFESFNG
MVSTASVHTLRQTSLAWLDQYCSLPALRPTVLNSLRQLGTSTSILTDPGRIPEQATRAVT
EGTLGKPL
Download sequence
Identical sequences F6W681
ENSCJAP00000030962 ENSCJAP00000030962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]