SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031298 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031298
Domain Number 1 Region: 416-561
Classification Level Classification E-value
Superfamily CBS-domain pair 0.000000000000024
Family CBS-domain pair 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000031298
Domain Number - Region: 654-707
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00199
Family cAMP-binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031298   Gene: ENSCJAG00000016989   Transcript: ENSCJAT00000033082
Sequence length 951
Comment pep:novel chromosome:C_jacchus3.2.1:12:86584501:86660937:1 gene:ENSCJAG00000016989 transcript:ENSCJAT00000033082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAAAAAVGARLRDCCSRGAVLLLFFSLSPRPPAAAAWLLGLRPEDTAGGRVSLEGG
TLRAAEGTSFLLRVYFQPGPPATAARMPAPTLSSGENGTSDWAPRLVFIEEPPGGSGVAP
SAVPTRPPGPQRCREQSDWASDVEVLGPLRPGGVAGSALVQVRVRELRKGEAERGGAGGG
GKLFSLCAWDGRAWHHHGAAGGFLLRVRPRLYGPGGDLLPPAWLRALGALLLLALSALFS
GLRLSLLSLDPVELRVLRNSGSAAEQEQARRVQAVRGRGTHLLCTLLLGQAGANAALAGW
LYASLPPGVGGAGEDYSEEGIHFPWLPALVCTGAVFLGAEICPYSVCSRHGLAIASHSVC
LTRLLMAAAFPVCYPLGRLLDWALRQEISTFYTREKLLETLRAADPYSDLVKEELNIIQG
ALELRTKVVEEVLTPLGDCFMLRSDAVLDFATVSEILRSGYTRIPVYEGDQRHNIVDILF
VKDLAFVDPDDCTPLLTVTRFYNRPLHCVFNDTRLDTVLEEFKKGKSHLAIVQRVNNEGE
GDPFYEVMGIVTLEDIIEEIIKSEILDETDLYTDNRKKQRVPHRERKRHDFSLFKLSDTE
MRVKISPQLLLATHRFMATEVEPFKSLYLSEKILLRLLKHPNVIQELKFDEKNKKAPEHY
LYQRNRPVDYFVLLLQGKVEVEVGKEGLRFENGAFTYYGVPAIMTTACSDNDVRKVGSLA
GSSVFLNRSPSRCSGLNRSESPNRERSDFGGSNTQLYSSNNNLYTPDYSVHILSDVQFVK
ITRQQYQNALTACHMDSSPQSPDMEAFTDGDSTKAPTTRGTPQTPKDDPVTMLLNNRNSL
PCSHSDGLRSPSEVVYLRMEELAFTQEEMTDFGEHSTQQLTLSTAAVPTRAASDSECCNI
NLDTETSPCSSDFEENVGKKLLRTLSGRKRKRSPEGERTSEENSNLTPLIT
Download sequence
Identical sequences F7I103
ENSCJAP00000031298 XP_002756556.1.60252 ENSCJAP00000031303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]