SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031551 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031551
Domain Number 1 Region: 1011-1207
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.97e-45
Family BAR domain 0.0026
Further Details:      
 
Domain Number 2 Region: 773-952
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.16e-42
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 
Domain Number 3 Region: 244-319
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-18
Family SH3-domain 0.00095
Further Details:      
 
Domain Number 4 Region: 1501-1572
Classification Level Classification E-value
Superfamily SH3-domain 1.18e-17
Family SH3-domain 0.0000185
Further Details:      
 
Domain Number 5 Region: 1276-1353
Classification Level Classification E-value
Superfamily SH3-domain 6.43e-16
Family SH3-domain 0.00000659
Further Details:      
 
Domain Number 6 Region: 143-204
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000197
Family SH3-domain 0.0009
Further Details:      
 
Domain Number 7 Region: 4-63
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000748
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 8 Region: 68-135
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000853
Family SH3-domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031551   Gene: ENSCJAG00000017162   Transcript: ENSCJAT00000033353
Sequence length 1575
Comment pep:novel chromosome:C_jacchus3.2.1:12:87137774:87236718:-1 gene:ENSCJAG00000017162 transcript:ENSCJAT00000033353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGSVVRAIFDFCPSVSEELPLFVGDVIEVLAVVDEFWLLGKKEDVTGQFPSSFVEIVT
IPSLKEGERLFVCICEFTSQELDSLLLHRGDLVILDGTPTAGWLQGRSCWGTRGFFPSSC
VRELCLSSQSQQWQSQSALLQIPEYSMGQARALMGLSAQLDEELDFREGDVITIIGVPEP
GWFEGELEGRRGIFPEGFVELLGPLRTVDESVSSGNPDDCIVNGEVDMSVGEEETRLDQE
EEEPGTYGVALYRFQALEPNELDFEVGDKIRILATLEDGWLEGSLKGRTGIFPYRFVKLC
PDTRVEETMLPQEGSLARIPETSLDCLENSLGVEEQRHATNEREAEEPDYIISEAPTSPL
GHLTSEYEADRNSYQDEDTAGGPPSSPGMDWEVPLATDSPTSDPAEVVNGISSQPQVPFH
PNLQKSQYYYTVGGSPSPSERYPDLIPLEARARDYASLPPKRMYSQPKTLQKPVLPLYRG
SSLSASRVVKPSQSSPQLQDIARYAKQHHTSSIYSASERSEVKPGPQAWGLVMEAATHSQ
GEGSTDLDSKLTQQLIEFEKSLSGPGTEPDKILRHFSIMDFNSEKDIVRGSSKLITEQEL
PERRKALRPPPPRPCTPVSTPSHVLVDQNVKPVPPLAVRPSRPAPLPPSAQQRMNAVSPK
LLSRHRPTCETLEKEGPGHMGKSLDQTSPCPLVLVRIEEMEQDLDMYNRAQEELNLMLEE
KQDESSRAETLEELKFCESNIESLNIELQQLREMTLLSSQSSSLVAPSGSVSTENPEQRM
LEKRAKVVEELLQTERDYIRDLEMCIERIMVPLQQAQVPNIDFEGLFGNMQMVIKVSKQL
LAALEISDAVGPVFLGHRDELEGTYKVYCQNHDEAIALLEIYEKDEKIQKHLQDSLADLK
SLYNEWGCTNYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKTPICSPFLVLSSLP
SDLSGLSKTYSLVLKYRKGDEDSLMEKISKLNIHSIIKKSNRVSSHLKHLTGFAPQIKDE
VFEETEKNFRMQERLIKSFIRDLSLYLQHIRESACVKVVAAMSMWDVCMERGHRDLEQFE
RVHRYISDQLFTNFKERTERLVISPLNQLLSMFTGPHKLVQKRFDKLLDFYNCTERAEKL
KDKKTLEELQSARNNYEALNAQLLDELPKFHQYAHGLFTNCIHGYAEAHRDFVHQALEQL
KPLLSLLKVADREGNLIAIFHEEHSRVLQQLQVFTFFPESLPATKKPFERKTIDRQSARK
PLLGLPSYMLQSEELRASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPM
GSQNRWLIDNGVTKGFVYSSFLKPYNPRRSHSDASVGSHSSTESEHGSSSPRFPRQNSGS
SLTFNPSSMTVSFTSSACPRQPQDASPLKECDQGTLIASLNLGNSESGPSRCPSDSDSSS
QPRSGDSADVARDVNQPTATPRSHRNFRHPETVGYSVPGRNGQGQDFTKGCARAAQPPED
RSPEPESSDAEGNQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNAEWWLAEVNGK
KGYVPSNYIRKTEYT
Download sequence
Identical sequences F7HSB4
ENSCJAP00000031551 ENSCJAP00000031551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]