SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031630 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031630
Domain Number 1 Region: 39-111
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.11e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031630   Gene: ENSCJAG00000017190   Transcript: ENSCJAT00000033435
Sequence length 252
Comment pep:novel chromosome:C_jacchus3.2.1:10:129661795:129680300:1 gene:ENSCJAG00000017190 transcript:ENSCJAT00000033435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEVSARRDAKKLVRSPSGLRMVPEHRAFGSPFGLEEPQWVPDKECRRCMQCDAKVDFL
TRKHHCRRCGKCFCTKCCSQKVPLRRMCFVDPVRQCAECALVSHKEAEFYDKQLKVLLSG
ATFLVTFGNSEKSETMICRLSNNQRYLFLDGDSHYEIEIAHISTVQILTEGFPPGEKDTH
AYTSLLGNQPVFEGGNARATGMFLQYMVPGTEGVTQLKLTAAEDANVGRRQAVAWLVAMH
KAAKLLYESRDQ
Download sequence
Identical sequences F7IJI5
ENSCJAP00000031616 ENSCJAP00000031630 XP_002807310.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]