SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032002 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032002
Domain Number 1 Region: 146-191
Classification Level Classification E-value
Superfamily RING/U-box 1.77e-18
Family RING finger domain, C3HC4 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032002   Gene: ENSCJAG00000017375   Transcript: ENSCJAT00000033825
Sequence length 214
Comment pep:novel scaffold:C_jacchus3.2.1:GL286420.1:615091:619038:-1 gene:ENSCJAG00000017375 transcript:ENSCJAT00000033825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARMAGERGASAVLFDITEDRAAAEQLQQPLGLTWPVVLIWGNDAEKLMEFVYKNRKAHVR
IELKEPPAWPDYDVWILLTVVGTIFVVILASVLRIRCRPRHSRPDPLQQRTAWAISQLAT
RRYKASCRRAQGKRPDSASSCSSAPVCAICLEEFSEGEELRVISCLHEFHRNCVDPWLHQ
HRTCPLCMFNIIGGRFISQSLGPSRSYQEPGRRL
Download sequence
Identical sequences H9KXA5
ENSCJAP00000032002 ENSCJAP00000032002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]