SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032206 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032206
Domain Number 1 Region: 92-220
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.42e-24
Family cAMP-binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 230-295,409-465
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000257
Family cAMP-binding domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032206   Gene: ENSCJAG00000017475   Transcript: ENSCJAT00000034045
Sequence length 573
Comment pep:novel chromosome:C_jacchus3.2.1:5:1185486:1240719:-1 gene:ENSCJAG00000017475 transcript:ENSCJAT00000034045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRYMVTHAWQLLKKELGLYQLARDIVIMIRVCKMFRQGLRGFREYQIIETAHRKHPAFS
FWDKKRQSRVTFDTKDFIAEKGHFPPRAIQIMQKKPSWRTEDEVQAVCNILQVLDSYRNF
EEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLGTVAVTKDDDGSSAFLDPHPIL
LHKGGYFGEMGLLDASVRRATIVCMEETEFLVVDREDFFAYKLDQEVRKDAQCQFEFFRK
MDLFASWSDKKLWQLIAMAKIEKFSYGQLISKDFVESSFIMFISKGSCEVLRLLDLAASP
SYHKWVWQHLELIHDRPLMTHLSEYSPLERYNEFQIKSYPLQDFSSLKLLHLQKAWELQG
TSFSRKIRTSGDSVPKMLGPKIKSKPTQTIKCNMINTNLGELPKEAVVGAYVKVHTVEQG
EILVFLPEGEHDTRPFILLSLGNEMIRIRKENFYKLIDNDDEMINKLLKLNIAYPSDEDM
CQKFLQENSWNVFRKDLLQLLVKHRQSSPFTPIRPKKKGIYDPRSVVLNLCSINKTTKPC
YPIFKAPQKYLPPLRIVQAIKAPRYKIQELLPQ
Download sequence
Identical sequences F7ESZ4
ENSCJAP00000032218 ENSCJAP00000032206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]