SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032522 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032522
Domain Number 1 Region: 4-211
Classification Level Classification E-value
Superfamily L domain-like 1.77e-33
Family Leucine rich effector protein YopM 0.033
Further Details:      
 
Domain Number 2 Region: 1244-1333
Classification Level Classification E-value
Superfamily PDZ domain-like 7.59e-23
Family PDZ domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032522   Gene: ENSCJAG00000017648   Transcript: ENSCJAT00000034372
Sequence length 1337
Comment pep:known chromosome:C_jacchus3.2.1:7:105686588:105825110:1 gene:ENSCJAG00000017648 transcript:ENSCJAT00000034372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEVLDQIQNLRELWMDNNALQVLPGSIGKLKMLVYLDMSKNRIETVDMDISGCEALEDLL
LSSNMLQQLPDSIGLLKKLTTLKVDDNQLTILPNTIVNSSLLQPKDCSVSGAYSVPSTFF
PAISNQALKQDNNILPSILLEIGSCKNVTVMSLRSNKLEFLPEEIGQMQKLRVLNLSDNR
LKNLPFSFTKLKELAALWLSDNQSKALIPLQTEAHPETKQRVLTNYMFPQQPRGDEDFQS
DSDSFNPTLWEEQRQQRMTVAFEFEDKKEDDENAGKVKDLSCQAPWERGQRGITLQPARL
SGDCCTPWARCDQQIQDMPVPQNDPQLAWGCISGLQQERSMCTPLPVAAQSTTLPSLSGR
QVEINLKRYPTPYPEDLKNMVKSVQNLVGKPSHGVRVENSNPTANTEQTVKEKYEHKWPV
APKEITVEDSFVHPANELRIGELHPSLAETPLYPPKLVLLGKDKKESTDESEVDKTHCLN
NSVSSGTYSDYSPSQASSGSSNTRVKVGSLQTTAKDAVHNSLWGNRIAPSFPQPLDAKPL
LSQREAVPPGNIPQRPDRLPMSDAFTDNWTDGSHYDNTGFVAEEATAENANSNPLLSSKS
RSTSSHGRRPLIRQDRIVGVPLELEQSTHRHTPETEVPPSNPWQNWTRTPSPFEDRTAFP
SKLETTPTTSPLPERKEHIKESTEIPSPFSPGVPWEYHDSNPNRSLSNVFSQIHCRPESS
KGVISISKSTERLSPLMKDIKSNKFKKSQSIDEIDIGTYKVYNIPLENYATGSDHLGSHE
RPDKMLGPEHGMSSMSRSQSVPMLDDEMLTYGSSKGPQQQKASMTKKVYQFDQSFNPQGS
VEVKAERIPPPFQHNPEYMQQASKNIAKDLISPRAYRGYPPMEQIFSFSQPSVNEDAVVN
AQFASQGARAGFLRRADSLVSATEMAMFRRVNEPHELPPTDRYGRPPYRGGLDRQSSVTV
TESQFLKRNGRYEDEHPSYQEVKAQAGSFPVKNLTQRRPLSARSYSTESYGASQTRPVSA
RPTMAALLEKIPSDYNLGNYGDKPSDNSDLKTRPTPVKGEESCGKMPADWRQQLLRHIEA
RRLDRNAAYKHNTVNLGMLPYGGISAMHAGRSMTLNLQTKSKFDHQELPLHKTPSQQSNI
LDNGQEDISPSGQWNPYPLGRRDVPPDTITKKAGSHIQTLMGSQSLQHRSREQQPYEGNI
NKVTIQQFQSPLPIQIPSSQATRGPQPGRCLIQTKGQRSMDGYPEQFCVRIEKNPGLGFS
ISGGISGQGNPFKPSDKGIFVTRVQPDGPASNLLQPGDKILQANGHSFVHMEHEKAVLLL
KSFQNTVDLVIQRELTV
Download sequence
Identical sequences F7GW34
ENSCJAP00000032522 ENSCJAP00000032522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]