SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032608 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032608
Domain Number 1 Region: 3-34,73-133
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.1e-19
Family Voltage-gated potassium channels 0.0048
Further Details:      
 
Domain Number 2 Region: 148-245
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.79e-17
Family Voltage-gated potassium channels 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032608   Gene: ENSCJAG00000017683   Transcript: ENSCJAT00000034465
Sequence length 327
Comment pep:novel chromosome:C_jacchus3.2.1:5:38891582:38896664:1 gene:ENSCJAG00000017683 transcript:ENSCJAT00000034465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRPSVRAAGLVLCTLCYRLVGAAVFDALESKAESGRQRLLVQKRGALRGKFGFSAEDCR
ELERLALGRAPPRRRQWKFAGSFYFAITVITTIGYSHAAPGTDSGKVFCMFSALLGIPLT
LVTFQSLGERLNALVQCLLLAAKRCLGLRRARVSTENLVVAGLLACATTLALGAVAFTHF
EGWTFFHAYYYCFITLTTIGFSDFVALQSGEALQRKPPYVAFSFLYILLGLTVIGAFLNL
VVLRFPAASADGSERAACGPSPHHQGEPESRDPSLPRPAGSGGSASVSCHVHQMEKCARH
NLGFLPPSSPGVVRRQAVRPGARWKSI
Download sequence
Identical sequences F7ERL3
ENSCJAP00000032608 ENSCJAP00000032608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]