SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032961 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032961
Domain Number 1 Region: 11-287
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.63e-78
Family FCH domain 0.0000000165
Further Details:      
 
Domain Number 2 Region: 524-597
Classification Level Classification E-value
Superfamily SH3-domain 6.04e-17
Family SH3-domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000032961
Domain Number - Region: 402-469
Classification Level Classification E-value
Superfamily HR1 repeat 0.0144
Family HR1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032961   Gene: ENSCJAG00000017821   Transcript: ENSCJAT00000034834
Sequence length 607
Comment pep:novel chromosome:C_jacchus3.2.1:7:130000540:130020369:1 gene:ENSCJAG00000017821 transcript:ENSCJAT00000034834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FHWELQSRDDQFDSLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSS
KDEEPRFTSCIAFFNILNELNDYAGQREVVAEEMAHRVYGELMRYAHDLKTERKMHLQEG
RKAQQYLDMCWKQMDNSKKKFERECREAEKAQQSYERLDNDTNATKADVEKAKQQLNLRT
HMADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTVKLSECYRGFADSERK
VIPIISKCLEGMILAAKSVDERRDSQMVVDSFKSGFEPPGDFPFEDYSQHIYRTISDGTI
SASKQESGKMDAKTTVGKAKGKLWLFGKKPKPQSPPLTPTSLFTSSTPNGSQFLTFSIEP
VHYCMNEIKTGKPRIPSFRSLKRGVSLIMGGPALEDFSHLPPEQRRKKLQQRIDELNREL
QKESDQKDALNKMKDVYEKNPQMGDPGSLQPKLAETMNNIDRLRMEIHKNEAWLSEVEGK
TGGRGDRRHSSDINHLVTQGRESPEGSYTDDANQEVRGPPQQHGHHSEFDDEFEDDDPLP
AIGHCKAIYPFDGHNEGTLAMKEGEVLYIIEEDKGDGWTRARRQNGEEGYVPTSYIDVTL
EKNSKGS
Download sequence
Identical sequences F7G804
ENSCJAP00000032970 ENSCJAP00000032961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]