SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000033109 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000033109
Domain Number 1 Region: 259-342
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000731
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000033109   Gene: ENSCJAG00000017936   Transcript: ENSCJAT00000034987
Sequence length 570
Comment pep:novel chromosome:C_jacchus3.2.1:10:117130264:117131999:-1 gene:ENSCJAG00000017936 transcript:ENSCJAT00000034987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAELTVEVRGSTGFLQGIYHDIHEHSLTAVFENNWQLERQVPVNEVRFPPPELKKELSEG
DEVEVYSRANDQEPREWWLAKVRVIKGEFYIIEYAACEATYNEIVTFERLWPVNQNKTVK
KRTFFKCTVRAPEDVREACVNENAHRFEEQAEVFHLPETAQLMTLSASEAVKRASTLSDM
HLRSICTKMMLMRNEEATTHSECTEQLAAAFHEEVVREDLRGPAIGTRGVPGVTAIELEE
DTATFRIYGESADAVKEARGFWEFVEDFIQIPRNLIGKVIGKNGKVIQEIVNKSCVVLVR
IEGGNENKRPREDGVVPFALVGTKESIGNAQALLEYHVAYLKEAEQLRMEHLQGDEQLRQ
IGSRSYSGRGRGHQGPNYASSDGTNSERSNLSEIESEHKDELSDWSLAGEDDRQLTSVCQ
QESPGGRDRSVSGGRGHGGPRGSKSSISSVLQDPDSSPYSLLGNTESDQTADTDACESPH
STNRKWAPRRRTDEDALLMDGITESDTAGANENGLAKDVMEEHGLSEKAINGPTSASGDD
ISKLQRTPGEEKINTKRKNSQAAAVLNGIS
Download sequence
Identical sequences F6SXQ7
ENSCJAP00000033109 ENSCJAP00000033109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]