SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000033204 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000033204
Domain Number 1 Region: 16-144
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.54e-38
Family Rps19E-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000033204   Gene: ENSCJAG00000017984   Transcript: ENSCJAT00000035090
Sequence length 151
Comment pep:novel chromosome:C_jacchus3.2.1:5:131469610:131470194:1 gene:ENSCJAG00000017984 transcript:ENSCJAT00000035090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALSPGWWRGGCTMPGITVKDVNQQEFIRALAAFLKKSRKLKVPEWVDTIKLAKHRELAPC
DKNWFYIVRHLYLQGGVGVGPMTMIYGDQRNGVMLNHFSTGSKSLAHQVLQVLEGLKMDP
MTTIGGCKLTPQGQRDLDRIVGQLGAANEKH
Download sequence
Identical sequences F6RCX6
ENSCJAP00000033204 ENSCJAP00000033204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]