SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000033438 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000033438
Domain Number 1 Region: 22-304
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.8e-48
Family FCH domain 0.0097
Further Details:      
 
Domain Number 2 Region: 548-630
Classification Level Classification E-value
Superfamily SH3-domain 4.26e-16
Family SH3-domain 0.0017
Further Details:      
 
Domain Number 3 Region: 455-530
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000538
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000033438   Gene: ENSCJAG00000018093   Transcript: ENSCJAT00000035329
Sequence length 691
Comment pep:known chromosome:C_jacchus3.2.1:2:38610647:38622354:-1 gene:ENSCJAG00000018093 transcript:ENSCJAT00000035329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPPRKVKPAQEVKLRFLEQLSILQTRQQREADLLEDIRSYSKQRAAIEREYGQALQKL
AGPFLKREGHRSGEMDNRRGRTVFGAWRCLLDATVAGGQTRIQASDRYRDLAGGTGRSAK
EQVLRKGTENLQRAQAEVLQSVRELSRSRKLYGQRERVWALAQEKAADVQARLNRSDHGI
FHSRTSLQKLSTKLSTQSAQYSQQLRAARNEYLLNLVATNAHLDHYYQEELPALLKALVS
ELSEHLRDPLTSLSCTELEAAEVILEHAHRGEQTISQVSWEQDLKLFLQEPGVFSPTPPQ
QFQPAGTDQVCVLEWGAEGMAGESGLEKEVQRLTSRAARDYKIQNHGHRVRWGAQQRRQQ
ALEREVPGIEQRLQEVRESIHRAQVSQVKGAARLALLQGAGLDVQRWLKPAMTQAQDEVE
QERRLSEARLSQRDLSPTAEDADLSDFEECEETGELFEEPAPSALATRPLPCPAHVVFRY
QAGHEDELTIMEGEWLEVIEEGDADEWVKARNQHGEVGFVPERYLNFPDLSLPENGQDSD
NPSGAEPTAFLARALYSYTGQSVEELSFPEGALIRLLPRAQDGVDDGFWRGEFGGCVGVF
PSLLVEELLGPPGPPELSDPEQVLPSPSPPSFSPPVPTSALDGPPAPVLPGDKALDFPGL
LDMMAPRLRPMRPPPPPPAKARDPDHTDPLT
Download sequence
Identical sequences F6RAR3
ENSCJAP00000033438 ENSCJAP00000033438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]