SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000033446 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000033446
Domain Number 1 Region: 4-171,202-216
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.1e-54
Family Ribonuclease PH domain 1-like 0.0000000374
Further Details:      
 
Domain Number 2 Region: 188-273
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.1e-25
Family Ribonuclease PH domain 2-like 0.00000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000033446   Gene: ENSCJAG00000018078   Transcript: ENSCJAT00000035337
Sequence length 276
Comment pep:known chromosome:C_jacchus3.2.1:5:150213690:150222803:1 gene:ENSCJAG00000018078 transcript:ENSCJAT00000035337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVIC
GVKAEFAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQ
KEDLCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINGETALAEVN
LKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTIVMDEEGKLCCLHKPGG
SGLTGAKLQDCMSRAVTRHKEVKKLMDEVIKSIKPK
Download sequence
Identical sequences F6R171
ENSCJAP00000033446 ENSCJAP00000033446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]