SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000033562 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000033562
Domain Number - Region: 82-131
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000113
Family cAMP-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000033562   Gene: ENSCJAG00000035499   Transcript: ENSCJAT00000035454
Sequence length 287
Comment pep:novel chromosome:C_jacchus3.2.1:12:90451151:90477088:1 gene:ENSCJAG00000035499 transcript:ENSCJAT00000035454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DNRTKKKVAHRERKQDFSAFKQTDSEMKVKISPQLLLAMHLVFISIEVEAFSPSQMSEKI
LLRLLKHPNVIQELKYDEKNKKAPEYYLYQRNKPVDYFVLILQGKVEVEAGKEGMKFEAS
AFSYYGVMALTASPVPLSLSRTFVVSRTELLAAGSPGENKSPPRPCGLNHSDSLSRSDRI
DAVTPTLGSSNNQLNSSLLQVYIPDYSVRALSDLQFVKISRQQYQNALMASRMDKTPQSS
DSENTKIELTLTELHDGLPDETANLLNEQNCVTHSKANHSLHSEGAI
Download sequence
Identical sequences F6T475
ENSCJAP00000033562 ENSCJAP00000033562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]