SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000033932 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000033932
Domain Number 1 Region: 274-376
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.28e-22
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00042
Further Details:      
 
Domain Number 2 Region: 31-104
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000131
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 118-185
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000196
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000033932   Gene: ENSCJAG00000018261   Transcript: ENSCJAT00000035848
Sequence length 850
Comment pep:novel chromosome:C_jacchus3.2.1:3:138025638:138136479:1 gene:ENSCJAG00000018261 transcript:ENSCJAT00000035848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFTVSCGKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKELSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRT
HRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPEAAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMMQRRSSF
SSQSINSQSVGSSLTQPVMSQATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQ
VVPSNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLGGHSQQTSLPSQTQSTLTAP
LYNTMVISQPAAGSMVQIPSSMPQNSTQSAAVTTFTQDRQIRFSQGQQLVTKLVTAPVAC
GAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVTQQQQQQQQQQSSQEQQLTSVQQPSQA
QLTQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTDS
LPDPSKVQPQ
Download sequence
Identical sequences F6TMY8
XP_008991583.1.60252 XP_008991585.1.60252 XP_017826046.1.60252 XP_017826047.1.60252 ENSCJAP00000033939 ENSCJAP00000033932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]