SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000034008 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000034008
Domain Number 1 Region: 62-163
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-24
Family Ras-binding domain, RBD 0.0049
Further Details:      
 
Domain Number 2 Region: 954-1060
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-23
Family PDZ domain 0.0000135
Further Details:      
 
Domain Number 3 Region: 249-356
Classification Level Classification E-value
Superfamily SMAD/FHA domain 7.23e-16
Family FHA domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000034008   Gene: ENSCJAG00000018360   Transcript: ENSCJAT00000035927
Sequence length 1072
Comment pep:known chromosome:C_jacchus3.2.1:2:15732434:15819575:1 gene:ENSCJAG00000018360 transcript:ENSCJAT00000035927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYGTHFIMSPPTKSKLKRQSQLLSSMLSRTLSYKYRDLDSTFSSLGANDDPAELSTQLS
APGVLKVFGDSVCTGAHYKSVLATGTSSARELVKEALERYALDPGQAGQYVLCDVVGQAG
DAGQRWQAQCFRVFGDSEKPLLIQELWKPREGLSRRFELRKRSDVEELAAKEVDTITAGI
NAQARRLQRSRAKGTPALALEDARSSPPPLLRRTVSETSLSPATALPATAHGPEEPGPDA
MRYSLYQSPHLLLLQGYSQQHDSLVYVLNRDRHTVGQRTPSSKPSIILSAPDILPLHCTI
RRHPLPDSGQAGGRLVLEPIPGAPISVNFSEVGRRTVVLHHGDLLSLGLYYLLLFKDPEQ
AQPLPAHALARLRAMPQSCRLCGAVLGARGATSPTQAALPSRQQLLLEFEPQLEDMLLQR
IMTLIEPGGDDHKLTPAFLLCLCIQHSATHFEPGTFGQLLLKIARLIRETVWEKTKELAE
KQAPLQEPFSPASCAMTDLVPDLQPILFWMSNSIELLYFIQQKCPLYMQSMEEQLDITGS
KESLFSCTLTTSEEAMAVLEEVVLYAFQQCVYYISKSLYICLPALLECPPFQMERRESWS
SAPELPEELHRVVSVYQAALDLLQQLQVHPEVASQMLAYLFFFSGTLLLNQLLDRGPSLS
CFHWPRGVQACARLQQLLEWMRSTGFGVAGEHFFRKLSCTLNLLATPRAQLIQMSWAALR
AAFPALSPAQLHRLLTHYQLASTMGPMSAWEPGTQDSPDDFRSEDVLESYENPPPIVLPS
EGFQVDLEADCLDASIYQHLLYIRHFLWGLRSRASPGSPGSRAPQPACPEGVHHAVPEGH
PEAPSCPLASRDPGPAAREAASEHTLPLRGAPWAQAPSGRQPGCRGSQAGPPHKDSSCLL
TPPSTPLGPEPGDPDWPVLGGPCGKALPERQRNGPRGLPGTASEGDSAAPKDESPPAPSS
CSSSTEDFCYVFMVELERGPSGLGMGLIDGMHTRLGTPGLYIQTLLPGSPAAADGRLSLG
DRILEVNGSSLLGLGYLRAVDLIRHGGKKMRFLVAKSDVETAKKIHFRTPPL
Download sequence
Identical sequences F7BUP5
XP_008982028.1.60252 ENSCJAP00000034008 ENSCJAP00000034008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]