SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000034551 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000034551
Domain Number 1 Region: 249-324
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.72e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000294
Further Details:      
 
Domain Number 2 Region: 8-83
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.01e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.000016
Further Details:      
 
Domain Number 3 Region: 95-182
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.06e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000034551   Gene: ENSCJAG00000018590   Transcript: ENSCJAT00000036488
Sequence length 333
Comment pep:novel chromosome:C_jacchus3.2.1:9:42346157:42369781:1 gene:ENSCJAG00000018590 transcript:ENSCJAT00000036488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIIT
LAGPTNAIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKI
KEIRESTGAQVAGDMLPNSTERAITIAGIPQSIIECVKQICVVMLETLSQSPPKGVTIPY
RPKPSSSPVIFAGGQAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSP
EVKGYWAGLDASAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTD
RQVTITGSAASISLAQYLINVRLSSETGGMGSS
Download sequence
Identical sequences F7I1G3
ENSCJAP00000034551 ENSCJAP00000034599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]