SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000034583 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000034583
Domain Number 1 Region: 131-215
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000236
Family HLH, helix-loop-helix DNA-binding domain 0.0000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000034583   Gene: ENSCJAG00000018614   Transcript: ENSCJAT00000036521
Sequence length 295
Comment pep:novel chromosome:C_jacchus3.2.1:12:97742636:97800473:1 gene:ENSCJAG00000018614 transcript:ENSCJAT00000036521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRGRPRKEARCEGAGLAPAAPPAVPPAVAAPQTPALPEEPAGAKPRCPFSDIFNTSEN
SMEKHINTFLQNVQILLEAASYLEQIEKENKKCEHGYASSFASMPSPRLQHSKPPRRLSR
AQKHSSGSSNTSTANRSTHNELEKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAK
AHIKKLEEAERKSQHQLENLEREQRFLKRRLEQLQGPQEMERIRMDSIGSTISSDRSDSE
REEIEVDVESTEFSHGEVDNISTTSISDIDDHSSLQSIGSDEGYSSASVKLSFTS
Download sequence
Identical sequences F7I1G6
ENSCJAP00000034583 ENSCJAP00000034593 XP_002756634.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]