SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000034795 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000034795
Domain Number 1 Region: 18-116
Classification Level Classification E-value
Superfamily DEATH domain 4.24e-21
Family Caspase recruitment domain, CARD 0.015
Further Details:      
 
Domain Number 2 Region: 680-755
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000506
Family PDZ domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000034795
Domain Number - Region: 177-438
Classification Level Classification E-value
Superfamily Tropomyosin 0.00785
Family Tropomyosin 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000034795   Gene: ENSCJAG00000018725   Transcript: ENSCJAT00000036747
Sequence length 1052
Comment pep:novel chromosome:C_jacchus3.2.1:2:17646520:17687388:1 gene:ENSCJAG00000018725 transcript:ENSCJAT00000036747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGGGPEMDDYMETLKDEEDALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEVL
NAPMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKEPTRRFSTIVVE
EGHEGLTHFLMNEVIKLQQQMKAKDLQRCELLARLRQLEDEKKQMTLTRMELLTFQERYY
KMKEERDSYNDELVKVKDDNYNLAMRYAQLSEEKNMAVMRSRDLQLEIDQLKHRLNKMEE
ECKLERNQSLKLKNDIENRPKKEQVLELERENEMLKTKNQELQSIIQAGKRSLPDSDKAI
LDILEHDRKEALEDRQELVNRIYNLQEEARQAEELRDKYLEEKEDLELKCSTLGKDCEMY
KHRMNTVMLQLEEVERERDQAFHSRDEAQTQYSQCLIEKDKYRKQIRELEEKNDEMRIEM
VRREACIVNLESKLRRLSKDSSNLDQSLPRNLPVTIISQNLGDASPRTNGQEADDSSTSE
ESPEDSKYFLPYHPPQRRMNLKGIQLQRAKSPISLKRASDFQAKGHEEEGTDTSPSSCGS
LPITNSFTKMQPPRSRSSIMSITAEPPGNDSIVRRYKEDAPHRSTVEEDNDSGGFDALDL
DDDSHERYSFGPPSVHSSSSSHQSEGLDAYDLEQVNLMFRKFSLERPFRPSVTSVGHVRG
PGPSVQHTTLNGDSLISQLTLVGGNVRGSFVHSVKPGSLAEKAGLREGHQLLLLEGCIRG
ERQSVPLDTCTKEEARWTIQRCSGPVTLHYKVNHEGYRKLLKDMEDGLITSGDSFYIRLN
LNISSQLDACTMSLKCDDVVHVRDTMYQDRHEWLCARVDPFTGHDLDMGTIPSYSRAQQL
LLVKLQRLMHRGSREEVDGAHHTLRALRNTLQPEEALSSSDPRVSPRLSRASFLFGQLLQ
VRLSRRHPNQNDRAFASPVSFHPLTDRLEDSLFAVQILIERSEALDPESELGKNLSLIPY
SLVRAFYCERRRPVLFTPTSLAKTLVQRLLNSGGAMEFTICKSDIVTRDEFLRKQKMETI
IYSREKNPNTFECISPSNIEAVAAKNKHCLLE
Download sequence
Identical sequences F7I1C3
ENSCJAP00000034795 ENSCJAP00000034795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]